PDB entry 3nhm

View 3nhm on RCSB PDB site
Description: Crystal structure of a response regulator from Myxococcus xanthus
Class: signaling protein
Keywords: Protein Structure Initiative II(PSI II), NYSGXRC, Structural Genomics, New York SGX Research Center for Structural Genomics, SIGNALING PROTEIN
Deposited on 2010-06-14, released 2010-07-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-07-21, with a file datestamp of 2010-07-16.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: 0.23
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Response regulator
    Species: Myxococcus xanthus [TaxId:246197]
    Gene: MXAN_5889
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nhma_
  • Chain 'B':
    Compound: Response regulator
    Species: Myxococcus xanthus [TaxId:246197]
    Gene: MXAN_5889
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nhmb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nhmA (A:)
    mslkpkvlivenswtmretlrlllsgefdcttaadgasglqqalahppdvlisdvnmdgm
    dgyalcghfrseptlkhipvifvsgyaprtegpadqpvpdaylvkpvkppvliaqlhall
    araeaeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nhmA (A:)
    pkvlivenswtmretlrlllsgefdcttaadgasglqqalahppdvlisdvnmdgmdgya
    lcghfrseptlkhipvifvsgyapadqpvpdaylvkpvkppvliaqlhallarae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nhmB (B:)
    mslkpkvlivenswtmretlrlllsgefdcttaadgasglqqalahppdvlisdvnmdgm
    dgyalcghfrseptlkhipvifvsgyaprtegpadqpvpdaylvkpvkppvliaqlhall
    araeaeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nhmB (B:)
    pkvlivenswtmretlrlllsgefdcttaadgasglqqalahppdvlisdvnmdgmdgya
    lcghfrseptlkhipvifvsgyapadqpvpdaylvkpvkppvliaqlhallarae