PDB entry 3nh9

View 3nh9 on RCSB PDB site
Description: Nucleotide Binding Domain of Human ABCB6 (ATP bound structure)
Deposited on 2010-06-14, released 2010-08-25
The last revision was dated 2012-03-21, with a file datestamp of 2012-03-16.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.179
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-binding cassette sub-family B member 6, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ABCB6, MTABC3, PRP, UMAT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NP58 (21-End)
      • expression tag (19-20)
  • Heterogens: ATP, BME, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nh9A (A:)
    mgsshhhhhhssglvprgshmfidmenmfdllkeetevkdlpgagplrfqkgriefenvh
    fsyadgretlqdvsftvmpgqtlalvgpsgagkstilrllfrfydissgciridgqdisq
    vtqaslrshigvvpqdtvlfndtiadnirygrvtagndeveaaaqaagihdaimafpegy
    rtqvgerglklsggekqrvaiartilkapgiilldeatsaldtsneraiqaslakvcanr
    ttivvahrlstvvnadqilvikdgcivergrheallsrggvyadmwqlqqgqeetsedtk
    pqtmer
    

    Sequence, based on observed residues (ATOM records):
    >3nh9A (A:)
    hmfidmenmfdllkeetevkdlpgagplrfqkgriefenvhfsyadgretlqdvsftvmp
    gqtlalvgpsgagkstilrllfrfydissgciridgqdisqvtqaslrshigvvpqdtvl
    fndtiadnirygrvtagndeveaaaqaagihdaimafpegyrtqvgerglklsggekqrv
    aiartilkapgiilldeatsaldtsneraiqaslakvcanrttivvahrlstvvnadqil
    vikdgcivergrheallsrggvyadmwqlqqgq