PDB entry 3nh8

View 3nh8 on RCSB PDB site
Description: Crystal structure of murine aminoacylase 3 in complex with N-acetyl-S-1,2-dichlorovinyl-L-cysteine
Class: hydrolase
Keywords: N-acetyl-S-1,2-dichlorovinyl-L-cysteine, HYDROLASE
Deposited on 2010-06-14, released 2010-10-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-11-03, with a file datestamp of 2010-10-29.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.178
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aspartoacylase-2
    Species: Mus musculus [TaxId:10090]
    Gene: ACY-3, Acy3, Aspa2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91XE4
      • engineered mutation (185)
    Domains in SCOPe 2.07: d3nh8a_
  • Heterogens: ZN, CL, DC2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nh8A (A:)
    mwshpqfekmsslpgsrepllrvavtggthgnemcgvylarywlqnpgelqrpsfsampv
    lanpaataaccryldrdlnrsctltflgstatpddpyevkrarelnqllgpkgtgqafdf
    tldlhnttantgvclisesnisfnlhlchylqrqnpgmpcrlflyepagtetfsvesisk
    ngiclamgpqpqgvlradlfsrmralvasildfielfnqgmdlpafemdiyrnlgsvdfp
    rtadgdlagtvhpqlqdhdfeplrpgepifklfsgedvlyegdsivypvfineaayyekh
    vaflksekirvtvpallrltprstqtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nh8A (A:)
    srepllrvavtggthgnemcgvylarywlqnpgelqrpsfsampvlanpaataaccryld
    rdlnrsctltflgstatpddpyevkrarelnqllgpkgtgqafdftldlhnttantgvcl
    isesnisfnlhlchylqrqnpgmpcrlflyepagtetfsvesiskngiclamgpqpqgvl
    radlfsrmralvasildfielfnqgmdlpafemdiyrnlgsvdfprtadgdlagtvhpql
    qdhdfeplrpgepifklfsgedvlyegdsivypvfineaayyekhvaflksekirvtvpa
    llrltp