PDB entry 3nh7

View 3nh7 on RCSB PDB site
Description: Crystal structure of the neutralizing Fab fragment AbD1556 bound to the BMP type I receptor IA
Class: immune system
Keywords: Antibody-antigen complex, BMP receptor extracellular domain, Bone morphogenetic protein, IMMUNE SYSTEM
Deposited on 2010-06-14, released 2010-10-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-10-27, with a file datestamp of 2010-10-22.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.236
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bone morphogenetic protein receptor type-1A
    Species: Homo sapiens [TaxId:9606]
    Gene: BMPR1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3nh7a_
  • Chain 'B':
    Compound: Bone morphogenetic protein receptor type-1A
    Species: Homo sapiens [TaxId:9606]
    Gene: BMPR1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3nh7b_
  • Chain 'C':
    Compound: Bone morphogenetic protein receptor type-1A
    Species: Homo sapiens [TaxId:9606]
    Gene: BMPR1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3nh7c_
  • Chain 'D':
    Compound: Bone morphogenetic protein receptor type-1A
    Species: Homo sapiens [TaxId:9606]
    Gene: BMPR1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3nh7d_
  • Chain 'H':
    Compound: Antibody fragment Fab AbD1556, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB PDB (0-End)
  • Chain 'I':
    Compound: Antibody fragment Fab AbD1556, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB PDB (0-End)
  • Chain 'J':
    Compound: Antibody fragment Fab AbD1556, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB PDB (0-End)
  • Chain 'K':
    Compound: Antibody fragment Fab AbD1556, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB PDB (0-End)
  • Chain 'L':
    Compound: Antibody fragment Fab AbD1556, light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB PDB
    Domains in SCOPe 2.06: d3nh7l1, d3nh7l2
  • Chain 'M':
    Compound: Antibody fragment Fab AbD1556, light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB PDB
    Domains in SCOPe 2.06: d3nh7m1, d3nh7m2
  • Chain 'N':
    Compound: Antibody fragment Fab AbD1556, light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB PDB
    Domains in SCOPe 2.06: d3nh7n1, d3nh7n2
  • Chain 'O':
    Compound: Antibody fragment Fab AbD1556, light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB PDB
    Domains in SCOPe 2.06: d3nh7o1, d3nh7o2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nh7A (A:)
    qnldsmlhgtgmksdsdqkksengvtlapedtlpflkcycsghcpddainntcitnghcf
    aiieeddqgettlasgcmkyegsdfqckdspkaqlrrtieccrtnlcnqylqptlppvvi
    gpffdgsir
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nh7A (A:)
    pflkcycsghcpddainntcitnghcfaiieeddqgettlasgcmkyegsdfqckdspka
    qlrrtieccrtnlcnqylqptlppv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nh7B (B:)
    qnldsmlhgtgmksdsdqkksengvtlapedtlpflkcycsghcpddainntcitnghcf
    aiieeddqgettlasgcmkyegsdfqckdspkaqlrrtieccrtnlcnqylqptlppvvi
    gpffdgsir
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nh7B (B:)
    pflkcycsghcpddainntcitnghcfaiieeddqgettlasgcmkyegsdfqckdspka
    qlrrtieccrtnlcnqylqptlppv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3nh7C (C:)
    qnldsmlhgtgmksdsdqkksengvtlapedtlpflkcycsghcpddainntcitnghcf
    aiieeddqgettlasgcmkyegsdfqckdspkaqlrrtieccrtnlcnqylqptlppvvi
    gpffdgsir
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nh7C (C:)
    pflkcycsghcpddainntcitnghcfaiieeddqgettlasgcmkyegsdfqckdspka
    qlrrtieccrtnlcnqylqptlppv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3nh7D (D:)
    qnldsmlhgtgmksdsdqkksengvtlapedtlpflkcycsghcpddainntcitnghcf
    aiieeddqgettlasgcmkyegsdfqckdspkaqlrrtieccrtnlcnqylqptlppvvi
    gpffdgsir
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nh7D (D:)
    pflkcycsghcpddainntcitnghcfaiieeddqgettlasgcmkyegsdfqckdspka
    qlrrtieccrtnlcnqylqptlppv
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3nh7L (L:)
    dieltqppsvsvapgqtariscsgdslgskyviwyqqkpgqapvlviyddsnrpsgiper
    fsgsnsgntatltisgtqaedeadyycstftmsgngtvfgggtkltvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyl
    sltpeqwkshrsyscqvthegstvektvaptea
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nh7L (L:)
    ieltqppsvsvapgqtariscsgdslgskyviwyqqkpgqapvlviyddsnrpsgiperf
    sgsnsgntatltisgtqaedeadyycstftmsgngtvfgggtkltvlgqpkaapsvtlfp
    psseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyls
    ltpeqwkshrsyscqvthegstvektvapt
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3nh7M (M:)
    dieltqppsvsvapgqtariscsgdslgskyviwyqqkpgqapvlviyddsnrpsgiper
    fsgsnsgntatltisgtqaedeadyycstftmsgngtvfgggtkltvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyl
    sltpeqwkshrsyscqvthegstvektvaptea
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nh7M (M:)
    ieltqppsvsvapgqtariscsgdslgskyviwyqqkpgqapvlviyddsnrpsgiperf
    sgsnsgntatltisgtqaedeadyycstftmsgngtvfgggtkltvlgqpkaapsvtlfp
    psseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyls
    ltpeqwkshrsyscqvthegstvektvapt
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3nh7N (N:)
    dieltqppsvsvapgqtariscsgdslgskyviwyqqkpgqapvlviyddsnrpsgiper
    fsgsnsgntatltisgtqaedeadyycstftmsgngtvfgggtkltvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyl
    sltpeqwkshrsyscqvthegstvektvaptea
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nh7N (N:)
    ieltqppsvsvapgqtariscsgdslgskyviwyqqkpgqapvlviyddsnrpsgiperf
    sgsnsgntatltisgtqaedeadyycstftmsgngtvfgggtkltvlgqpkaapsvtlfp
    psseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyls
    ltpeqwkshrsyscqvthegstvektvapt
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3nh7O (O:)
    dieltqppsvsvapgqtariscsgdslgskyviwyqqkpgqapvlviyddsnrpsgiper
    fsgsnsgntatltisgtqaedeadyycstftmsgngtvfgggtkltvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyl
    sltpeqwkshrsyscqvthegstvektvaptea
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nh7O (O:)
    ieltqppsvsvapgqtariscsgdslgskyviwyqqkpgqapvlviyddsnrpsgiperf
    sgsnsgntatltisgtqaedeadyycstftmsgngtvfgggtkltvlgqpkaapsvtlfp
    psseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyls
    ltpeqwkshrsyscqvthegstvektvapt