PDB entry 3nh2

View 3nh2 on RCSB PDB site
Description: Crystal structure of RNase T in complex with a stem DNA with a 3' overhang
Class: hydrolase/DNA
Keywords: exoribonuclease, RNA processing, RNA maturation, protein-DNA interactions, protein-DNA complex, exo-nuclease, HYDROLASE-DNA complex
Deposited on 2010-06-14, released 2011-02-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-21, with a file datestamp of 2011-12-16.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.19
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease T
    Species: Escherichia coli [TaxId:562]
    Gene: rnt
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nh2a_
  • Chain 'B':
    Compound: Ribonuclease T
    Species: Escherichia coli [TaxId:562]
    Gene: rnt
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nh2b_
  • Chain 'C':
    Compound: 5'-d(p*tp*tp*ap*cp*ap*ap*c)-3'
  • Chain 'D':
    Compound: 5'-d(p*tp*tp*ap*cp*ap*ap*c)-3'
  • Chain 'E':
    Compound: Ribonuclease T
    Species: Escherichia coli [TaxId:562]
    Gene: rnt
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nh2e_
  • Chain 'F':
    Compound: Ribonuclease T
    Species: Escherichia coli [TaxId:562]
    Gene: rnt
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nh2f_
  • Chain 'G':
    Compound: 5'-d(p*tp*tp*ap*cp*ap*ap*c)-3'
  • Chain 'H':
    Compound: 5'-d(p*tp*tp*ap*cp*ap*ap*c)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nh2A (A:)
    mgsshhhhhhssglvprgshmsdnaqltglcdrfrgfypvvidvetagfnaktdalleia
    aitlkmdeqgwlmpdttlhfhvepfvganlqpealafngidpndpdrgavseyealheif
    kvvrkgikasgcnraimvahnanfdhsfmmaaaeraslkrnpfhpfatfdtaalaglalg
    qtvlskacqtagmdfdstqahsalydtertavlfceivnrwkrlggwplsaaeev
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nh2A (A:)
    glcdrfrgfypvvidvetagfnaktdalleiaaitlkmdeqgwlmpdttlhfhvepfvga
    nlqpealafngidpndpdrgavseyealheifkvvrkgikasgcnraimvahnanfdhsf
    mmaaaeraslkrnpfhpfatfdtaalaglalgqtvlskacqtagmdfdsalydtertavl
    fceivnrwkrlggwplsaaeev
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nh2B (B:)
    mgsshhhhhhssglvprgshmsdnaqltglcdrfrgfypvvidvetagfnaktdalleia
    aitlkmdeqgwlmpdttlhfhvepfvganlqpealafngidpndpdrgavseyealheif
    kvvrkgikasgcnraimvahnanfdhsfmmaaaeraslkrnpfhpfatfdtaalaglalg
    qtvlskacqtagmdfdstqahsalydtertavlfceivnrwkrlggwplsaaeev
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nh2B (B:)
    glcdrfrgfypvvidvetagfnaktdalleiaaitlkmdeqgwlmpdttlhfhvepfvga
    nlqpealafngidpndpdrgavseyealheifkvvrkgikasgcnraimvahnanfdhsf
    mmaaaeraslkrnpfhpfatfdtaalaglalgqtvlskacqtagmdfdstqahsalydte
    rtavlfceivnrwkrlggwplsaaee
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3nh2E (E:)
    mgsshhhhhhssglvprgshmsdnaqltglcdrfrgfypvvidvetagfnaktdalleia
    aitlkmdeqgwlmpdttlhfhvepfvganlqpealafngidpndpdrgavseyealheif
    kvvrkgikasgcnraimvahnanfdhsfmmaaaeraslkrnpfhpfatfdtaalaglalg
    qtvlskacqtagmdfdstqahsalydtertavlfceivnrwkrlggwplsaaeev
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nh2E (E:)
    glcdrfrgfypvvidvetagfnaktdalleiaaitlkmdeqgwlmpdttlhfhvepfvga
    nlqpealafngidpndpdrgavseyealheifkvvrkgikasgcnraimvahnanfdhsf
    mmaaaeraslkrnpfhpfatfdtaalaglalgqtvlskacqtagmdfdstqahsalydte
    rtavlfceivnrwkrlggwplsaaee
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3nh2F (F:)
    mgsshhhhhhssglvprgshmsdnaqltglcdrfrgfypvvidvetagfnaktdalleia
    aitlkmdeqgwlmpdttlhfhvepfvganlqpealafngidpndpdrgavseyealheif
    kvvrkgikasgcnraimvahnanfdhsfmmaaaeraslkrnpfhpfatfdtaalaglalg
    qtvlskacqtagmdfdstqahsalydtertavlfceivnrwkrlggwplsaaeev
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nh2F (F:)
    glcdrfrgfypvvidvetagfnaktdalleiaaitlkmdeqgwlmpdttlhfhvepfvga
    nlqpealafngidpndpdrgavseyealheifkvvrkgikasgcnraimvahnanfdhsf
    mmaaaeraslkrnpfhpfatfdtaalaglalgqtvlskacqtagmdfdsalydtertavl
    fceivnrwkrlggwplsaaeev
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.