PDB entry 3ngy

View 3ngy on RCSB PDB site
Description: Crystal structure of RNase T (E92G mutant)
Class: hydrolase
Keywords: exoribonuclease, RNA processing, RNA maturation, protein-DNA interactions, exo-nuclease, HYDROLASE
Deposited on 2010-06-14, released 2011-02-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.178
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease T
    Species: Escherichia coli [TaxId:562]
    Gene: rnt
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30014
      • engineered mutation (111)
    Domains in SCOPe 2.07: d3ngya_
  • Chain 'B':
    Compound: Ribonuclease T
    Species: Escherichia coli [TaxId:562]
    Gene: rnt
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30014
      • engineered mutation (111)
    Domains in SCOPe 2.07: d3ngyb_
  • Chain 'C':
    Compound: Ribonuclease T
    Species: Escherichia coli [TaxId:562]
    Gene: rnt
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30014
      • engineered mutation (111)
    Domains in SCOPe 2.07: d3ngyc_
  • Chain 'D':
    Compound: Ribonuclease T
    Species: Escherichia coli [TaxId:562]
    Gene: rnt
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30014
      • engineered mutation (111)
    Domains in SCOPe 2.07: d3ngyd_
  • Chain 'E':
    Compound: his tag sequence
    Species: Escherichia coli [TaxId:562]
    Gene: rnt
    Database cross-references and differences (RAF-indexed):
    • PDB 3NGY (0-5)
  • Heterogens: CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ngyA (A:)
    mgsshhhhhhssglvprgshmsdnaqltglcdrfrgfypvvidvetagfnaktdalleia
    aitlkmdeqgwlmpdttlhfhvepfvganlqpealafngidpndpdrgavsgyealheif
    kvvrkgikasgcnraimvahnanfdhsfmmaaaeraslkrnpfhpfatfdtaalaglalg
    qtvlskacqtagmdfdstqahsalydtertavlfceivnrwkrlggwplsaaeev
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ngyA (A:)
    glcdrfrgfypvvidvetagfnaktdalleiaaitlkmdeqgwlmpdttlhfhvepfvga
    nlqpealafngidpndpdrgavsgyealheifkvvrkgikasgcnraimvahnanfdhsf
    mmaaaeraslkrnpfhpfatfdtaalaglalgqtvlskacqtagmdfdstqahsalydte
    rtavlfceivnrwkrlggwplsaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ngyB (B:)
    mgsshhhhhhssglvprgshmsdnaqltglcdrfrgfypvvidvetagfnaktdalleia
    aitlkmdeqgwlmpdttlhfhvepfvganlqpealafngidpndpdrgavsgyealheif
    kvvrkgikasgcnraimvahnanfdhsfmmaaaeraslkrnpfhpfatfdtaalaglalg
    qtvlskacqtagmdfdstqahsalydtertavlfceivnrwkrlggwplsaaeev
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ngyB (B:)
    tglcdrfrgfypvvidvetagfnaktdalleiaaitlkmdeqgwlmpdttlhfhvepfvg
    anlqpealafngidpndpdrgavsgyealheifkvvrkgikasgcnraimvahnanfdhs
    fmmaaaeraslkrnpfhpfatfdtaalaglalgqtvlskacqtagmdfdstqahsalydt
    ertavlfceivnrwkrlggwpl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ngyC (C:)
    mgsshhhhhhssglvprgshmsdnaqltglcdrfrgfypvvidvetagfnaktdalleia
    aitlkmdeqgwlmpdttlhfhvepfvganlqpealafngidpndpdrgavsgyealheif
    kvvrkgikasgcnraimvahnanfdhsfmmaaaeraslkrnpfhpfatfdtaalaglalg
    qtvlskacqtagmdfdstqahsalydtertavlfceivnrwkrlggwplsaaeev
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ngyC (C:)
    glcdrfrgfypvvidvetagfnaktdalleiaaitlkmdeqgwlmpdttlhfhvepfvgg
    avsgyealheifkvvrkgikasgcnraimvahnanfdhsfmmaaaeraslkrnpfhpfat
    fdtaalaglalgqtvlskacqtagmdfdstqahsalydtertavlfceivnrwkrlggwp
    ls
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ngyD (D:)
    mgsshhhhhhssglvprgshmsdnaqltglcdrfrgfypvvidvetagfnaktdalleia
    aitlkmdeqgwlmpdttlhfhvepfvganlqpealafngidpndpdrgavsgyealheif
    kvvrkgikasgcnraimvahnanfdhsfmmaaaeraslkrnpfhpfatfdtaalaglalg
    qtvlskacqtagmdfdstqahsalydtertavlfceivnrwkrlggwplsaaeev
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ngyD (D:)
    tglcdrfrgfypvvidvetagfnaktdalleiaaitlkmdeqgwlmpdttlhfhvepfvg
    anlqpealafngidpndpdrgavsgyealheifkvvrkgikasgcnraimvahnanfdhs
    fmmaaaeraslkrnpfhpfatfdtaalaglalgqtvlskacqtagmdfdstqahsalydt
    ertavlfceivnrwkrlggwpl
    

  • Chain 'E':
    No sequence available.