PDB entry 3ngw

View 3ngw on RCSB PDB site
Description: crystal structure of molybdopterin-guanine dinucleotide biosynthesis protein a from archaeoglobus fulgidus, northeast structural genomics consortium target gr189
Deposited on 2010-06-13, released 2010-08-11
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Molybdopterin-guanine dinucleotide biosynthesis protein A (MobA)
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_2005, mobA
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3ngwA (A:)
    mkvavlvggvgrrigmektevmlcgkkliewvlekyspfqtvfvcrdekqaeklssryea
    efiwdlhkgvgsiagihaalrhfgscvvaaidmpfvkpevlehlykegekagcdalipkh
    dypepllayyaesaadelerailqgirkilvplerlnvvyypveklrkfdkelisffnin
    tpddlkraeeicskmstegllehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3ngwA (A:)
    mkvavlvggvgrrigmektevmlcgkkliewvlekyspfqtvfvcrdekqaeklssryea
    efiwdlhkgvgsiagihaalrhfgscvvaaidmpfvkpevlehlykegekagcdalipkh
    dypepllayyaesaadelerailqgirkilvplerlnvvyypveklrkfdkelisffnin
    tpddlkraeeicskm