PDB entry 3ngu

View 3ngu on RCSB PDB site
Description: Structure of Leishmania NDKb complexed with ADP.
Class: transferase
Keywords: NDKb, ADP, TRANSFERASE
Deposited on 2010-06-13, released 2011-04-27
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-06-29, with a file datestamp of 2011-06-24.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: 0.22
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside diphosphate kinase
    Species: Leishmania major [TaxId:5664]
    Gene: L1648.07, LmjF32.2950, NDKb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3ngua_
  • Chain 'B':
    Compound: Nucleoside diphosphate kinase
    Species: Leishmania major [TaxId:5664]
    Gene: L1648.07, LmjF32.2950, NDKb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3ngub_
  • Heterogens: ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nguA (A:)
    mssertfiavkpdgvqrglvgeiiarferkgyklvalkilqptteqaqghykdlcskpff
    palvkyfssgpivcmvwegknvvksgrvllgatnpadsqpgtirgdfavdvgrnvchgsd
    svesaereiafwfkadeiaswtshsvsqiye
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nguB (B:)
    mssertfiavkpdgvqrglvgeiiarferkgyklvalkilqptteqaqghykdlcskpff
    palvkyfssgpivcmvwegknvvksgrvllgatnpadsqpgtirgdfavdvgrnvchgsd
    svesaereiafwfkadeiaswtshsvsqiye