PDB entry 3ngs

View 3ngs on RCSB PDB site
Description: Structure of Leishmania nucleoside diphosphate kinase b with ordered nucleotide-binding loop
Class: transferase
Keywords: LmNDKb, phosphate ion, ordered nucleotide-binding loop, TRANSFERASE
Deposited on 2010-06-13, released 2011-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside diphosphate kinase
    Species: Leishmania major [TaxId:5664]
    Gene: L1648.07, LmjF32.2950, NDKb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ngsa_
  • Chain 'B':
    Compound: Nucleoside diphosphate kinase
    Species: Leishmania major [TaxId:5664]
    Gene: L1648.07, LmjF32.2950, NDKb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ngsb_
  • Chain 'C':
    Compound: Nucleoside diphosphate kinase
    Species: Leishmania major [TaxId:5664]
    Gene: L1648.07, LmjF32.2950, NDKb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ngsc_
  • Heterogens: PO4, DTT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ngsA (A:)
    mssertfiavkpdgvqrglvgeiiarferkgyklvalkilqptteqaqghykdlcskpff
    palvkyfssgpivcmvwegknvvksgrvllgatnpadsqpgtirgdfavdvgrnvchgsd
    svesaereiafwfkadeiaswtshsvsqiye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ngsB (B:)
    mssertfiavkpdgvqrglvgeiiarferkgyklvalkilqptteqaqghykdlcskpff
    palvkyfssgpivcmvwegknvvksgrvllgatnpadsqpgtirgdfavdvgrnvchgsd
    svesaereiafwfkadeiaswtshsvsqiye
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ngsB (B:)
    ssertfiavkpdgvqrglvgeiiarferkgyklvalkilqptteqaqghykdlcskpffp
    alvkyfssgpivcmvwegknvvksgrvllgatnpadsqpgtirgdfavdvgrnvchgsds
    vesaereiafwfkadeiaswtshsvsqiye
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ngsC (C:)
    mssertfiavkpdgvqrglvgeiiarferkgyklvalkilqptteqaqghykdlcskpff
    palvkyfssgpivcmvwegknvvksgrvllgatnpadsqpgtirgdfavdvgrnvchgsd
    svesaereiafwfkadeiaswtshsvsqiye