PDB entry 3ngr

View 3ngr on RCSB PDB site
Description: Crystal structure of Leishmania nucleoside diphosphate kinase b with unordered nucleotide-binding loop.
Class: transferase
Keywords: NDKb, phosphate ion, TRANSFERASE
Deposited on 2010-06-13, released 2011-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside diphosphate kinase
    Species: Leishmania major [TaxId:5664]
    Gene: L1648.07, LmjF32.2950, NDKb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ngra_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ngrA (A:)
    mssertfiavkpdgvqrglvgeiiarferkgyklvalkilqptteqaqghykdlcskpff
    palvkyfssgpivcmvwegknvvksgrvllgatnpadsqpgtirgdfavdvgrnvchgsd
    svesaereiafwfkadeiaswtshsvsqiye
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ngrA (A:)
    mssertfiavkpdgvqrglvgeiiarferkgyklvalkilqsgpivcmvwegknvvksgr
    vllgatnpadsqpgtirgdfavdvgrnvchgsdsvesaereiafwfkadeiaswtsh