PDB entry 3ngp

View 3ngp on RCSB PDB site
Description: High resolution structure of alpha-spectrin SH3 domain mutant with a redesigned core
Deposited on 2010-06-12, released 2010-09-08
The last revision was dated 2012-03-21, with a file datestamp of 2012-03-16.
Experiment type: XRAY
Resolution: 1.08 Å
R-factor: 0.169
AEROSPACI score: 0.92 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Spectrin alpha chain, brain
    Species: Gallus gallus [TaxId:9031]
    Gene: SPTAN1, SPTA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07751 (Start-61)
      • engineered mutation (10)
      • engineered mutation (22)
      • engineered mutation (24)
      • engineered mutation (43)
      • engineered mutation (47)
      • engineered mutation (57)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3ngpA (A:)
    mdetgkelvlvlydyqekspreltvkkgdiltllnstnkdwwkievngrqgfvpaaylkk
    ld
    

    Sequence, based on observed residues (ATOM records):
    >3ngpA (A:)
    kelvlvlydyqekspreltvkkgdiltllnstnkdwwkievngrqgfvpaaylkkld