PDB entry 3ngo

View 3ngo on RCSB PDB site
Description: Crystal structure of the human CNOT6L nuclease domain in complex with poly(A) DNA
Deposited on 2010-06-12, released 2010-07-28
The last revision was dated 2010-07-28, with a file datestamp of 2010-07-23.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.217
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CCR4-NOT transcription complex subunit 6-like
    Species: Homo sapiens [TaxId:9606]
    Gene: CNOT6L, CCR4B
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: 5'-d(*ap*ap*ap*a)-3'
  • Heterogens: MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3ngoA (A:)
    mldnlavhpeqlpprpwitlkerdqilpsasftvmcynvlcdkyatrqlygycpswalnw
    eyrkkgimeeivncdadiislqeveteqyftlflpalkergydgffspksrakimseqer
    khvdgcaiffktekftlvqkhtvefnqvamansdgseamlnrvmtkdnigvavvlevhke
    lfgagmkpihaadkqllivanahmhwdpeysdvkliqtmmfvsevknilekassrpgspt
    adpnsiplvlcadlnslpdsgvveylsnggvadnhkdfkelryneclmnfscngkngsse
    grithgfqlksayennlmpytnytfdfkgvidyifyskthmnvlgvlgpldpqwlvenni
    tgcphphipsdhfslltqlelhppllplvngvhlpnrr
    

    Sequence, based on observed residues (ATOM records):
    >3ngoA (A:)
    lpprpwitlkerdilpsasftvmcynvlcdkyatrqlygycpswalnweyrkkgimeeiv
    ncdadiislqeveteqyftlflpalkergydgffspksrakimseqerkhvdgcaiffkt
    ekftlvqkhtvefnqvamansdgseamlnrvmtkdnigvavvlevhkelfkqllivanah
    mhwdpeysdvkliqtmmfvsevknilekasiplvlcadlnslpdsgvveylsnggvadnh
    kdfkelyneclmnfsrithgfqlksayennlmpytnytfdfkgvidyifyskthmnvlgv
    lgpldpqwlvennitgcphphipsdhfslltqlelhp
    

  • Chain 'B':
    No sequence available.