PDB entry 3ngn

View 3ngn on RCSB PDB site
Description: Crystal structure of the human CNOT6L nuclease domain in complex with AMP
Deposited on 2010-06-12, released 2010-07-28
The last revision was dated 2010-07-28, with a file datestamp of 2010-07-23.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.213
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CCR4-NOT transcription complex subunit 6-like
    Species: Homo sapiens [TaxId:9606]
    Gene: CNOT6L, CCR4B
    Database cross-references and differences (RAF-indexed):
  • Heterogens: AMP, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3ngnA (A:)
    mldnlavhpeqlpprpwitlkerdqilpsasftvmcynvlcdkyatrqlygycpswalnw
    eyrkkgimeeivncdadiislqeveteqyftlflpalkergydgffspksrakimseqer
    khvdgcaiffktekftlvqkhtvefnqvamansdgseamlnrvmtkdnigvavvlevhke
    lfgagmkpihaadkqllivanahmhwdpeysdvkliqtmmfvsevknilekassrpgspt
    adpnsiplvlcadlnslpdsgvveylsnggvadnhkdfkelryneclmnfscngkngsse
    grithgfqlksayennlmpytnytfdfkgvidyifyskthmnvlgvlgpldpqwlvenni
    tgcphphipsdhfslltqlelhppllplvngvhlpnrr
    

    Sequence, based on observed residues (ATOM records):
    >3ngnA (A:)
    lpprpwitlkerdsasftvmcynvlcdkyatrqlygycpswalnweyrkkgimeeivncd
    adiislqeveteqyftlflpalkergydgffspksrakimseqerkhvdgcaiffktekf
    tlvqkhtvefnqvamansdgseamlnrvmtkdnigvavvlevhkelfkqllivanahmhw
    dpeysdvkliqtmmfvsevknilekasiplvlcadlnslpdsgvveylsnggvadnhkdf
    kerithgfqlksayennlmpytnytfdfkgvidyifyskthmnvlgvlgpldpqwlvenn
    itgcphphipsdhfslltqlelhp