PDB entry 3ngm

View 3ngm on RCSB PDB site
Description: Crystal structure of lipase from Gibberella zeae
Deposited on 2010-06-12, released 2011-05-25
The last revision was dated 2011-05-25, with a file datestamp of 2011-05-20.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.238
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Extracellular lipase
    Species: GIBBERELLA ZEAE [TaxId:5518]
    Gene: FGL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6WER3 (0-End)
      • conflict (158)
      • conflict (315-317)
  • Chain 'B':
    Compound: Extracellular lipase
    Species: GIBBERELLA ZEAE [TaxId:5518]
    Gene: FGL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6WER3 (0-End)
      • conflict (158)
      • conflict (315-317)
  • Chain 'C':
    Compound: Extracellular lipase
    Species: GIBBERELLA ZEAE [TaxId:5518]
    Gene: FGL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6WER3 (0-End)
      • conflict (158)
      • conflict (315-317)
  • Chain 'D':
    Compound: Extracellular lipase
    Species: GIBBERELLA ZEAE [TaxId:5518]
    Gene: FGL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6WER3 (0-End)
      • conflict (158)
      • conflict (315-317)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3ngmA (A:)
    avsvsttdfgnfkfyiqhgaaaycnseapagakvtcsgngcptvqsngativasftgskt
    giggyvatdptrkeivvsfrgsinirnwltnldfdqddcsltsgcgvhsgfqnawneisa
    aataavakarkanpsfkvvsvghslggavatlaganlriggtpldiytygsprvgntqla
    afvsnqaggefrvtnakdpvprlpplifgyrhtspeywlsgsggdkidytindvkvcega
    anlqcnggtlgldidahlhyfqatdacsaggiswrryrsakresiseratmtdaelekkl
    nsyvemdkeyikthasrss
    

    Sequence, based on observed residues (ATOM records):
    >3ngmA (A:)
    avsvsttdfgnfkfyiqhgaaaycnseapagakvtcsgngcptvqsngativasftgskt
    giggyvatdptrkeivvsfrgsinirnwltnldfdqddcsltsgcgvhsgfqnawneisa
    aataavakarkanpsfkvvsvghslggavatlaganlriggtpldiytygsprvgntqla
    afvsnqaggefrvtnakdpvprlpplifgyrhtspeywlsgsggdkidytindvkvcega
    anlqcnggtlgldidahlhyfqatdacstmtdaelekklnsyvemdkeyikthasrs
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3ngmB (B:)
    avsvsttdfgnfkfyiqhgaaaycnseapagakvtcsgngcptvqsngativasftgskt
    giggyvatdptrkeivvsfrgsinirnwltnldfdqddcsltsgcgvhsgfqnawneisa
    aataavakarkanpsfkvvsvghslggavatlaganlriggtpldiytygsprvgntqla
    afvsnqaggefrvtnakdpvprlpplifgyrhtspeywlsgsggdkidytindvkvcega
    anlqcnggtlgldidahlhyfqatdacsaggiswrryrsakresiseratmtdaelekkl
    nsyvemdkeyikthasrss
    

    Sequence, based on observed residues (ATOM records):
    >3ngmB (B:)
    avsvsttdfgnfkfyiqhgaaaycnseapagakvtcsgngcptvqsngativasftgskt
    giggyvatdptrkeivvsfrgsinirnwltnldfdqddcsltsgcgvhsgfqnawneisa
    aataavakarkanpsfkvvsvghslggavatlaganlriggtpldiytygsprvgntqla
    afvsnqaggefrvtnakdpvprlpplifgyrhtspeywlsgsggdkidytindvkvcega
    anlqcnggtlgldidahlhyfqatdacstmtdaelekklnsyvemdkeyikthasrs
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3ngmC (C:)
    avsvsttdfgnfkfyiqhgaaaycnseapagakvtcsgngcptvqsngativasftgskt
    giggyvatdptrkeivvsfrgsinirnwltnldfdqddcsltsgcgvhsgfqnawneisa
    aataavakarkanpsfkvvsvghslggavatlaganlriggtpldiytygsprvgntqla
    afvsnqaggefrvtnakdpvprlpplifgyrhtspeywlsgsggdkidytindvkvcega
    anlqcnggtlgldidahlhyfqatdacsaggiswrryrsakresiseratmtdaelekkl
    nsyvemdkeyikthasrss
    

    Sequence, based on observed residues (ATOM records):
    >3ngmC (C:)
    avsvsttdfgnfkfyiqhgaaaycnseapagakvtcsgngcptvqsngativasftgskt
    giggyvatdptrkeivvsfrgsinirnwltnldfdqddcsltsgcgvhsgfqnawneisa
    aataavakarkanpsfkvvsvghslggavatlaganlriggtpldiytygsprvgntqla
    afvsnqaggefrvtnakdpvprlpplifgyrhtspeywlsgsggdkidytindvkvcega
    anlqcnggtlgldidahlhyfqatdacstmtdaelekklnsyvemdkeyikthasrs
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3ngmD (D:)
    avsvsttdfgnfkfyiqhgaaaycnseapagakvtcsgngcptvqsngativasftgskt
    giggyvatdptrkeivvsfrgsinirnwltnldfdqddcsltsgcgvhsgfqnawneisa
    aataavakarkanpsfkvvsvghslggavatlaganlriggtpldiytygsprvgntqla
    afvsnqaggefrvtnakdpvprlpplifgyrhtspeywlsgsggdkidytindvkvcega
    anlqcnggtlgldidahlhyfqatdacsaggiswrryrsakresiseratmtdaelekkl
    nsyvemdkeyikthasrss
    

    Sequence, based on observed residues (ATOM records):
    >3ngmD (D:)
    avsvsttdfgnfkfyiqhgaaaycnseapagakvtcsgngcptvqsngativasftgskt
    giggyvatdptrkeivvsfrgsinirnwltnldfdqddcsltsgcgvhsgfqnawneisa
    aataavakarkanpsfkvvsvghslggavatlaganlriggtpldiytygsprvgntqla
    afvsnqaggefrvtnakdpvprlpplifgyrhtspeywlsgsggdkidytindvkvcega
    anlqcnggtlgldidahlhyfqatdacstmtdaelekklnsyvemdkeyikthasrs