PDB entry 3ngl

View 3ngl on RCSB PDB site
Description: Crystal structure of bifunctional 5,10-methylenetetrahydrofolate dehydrogenase / cyclohydrolase from Thermoplasma acidophilum
Class: Oxidoreductase, Hydrolase
Keywords: Methylenetetrahydrofolate dehydrogenase/cyclohydrolase, Catalyzes the oxidation of 5, 10-methylenetetrahydrofolate to 5, 10-methenyltetrahydrofolate, the hydrolysis of 5, 10-methenyltetrahydrofolate to 10-formyltetrahydrofolate, Oxidoreductase, Hydrolase
Deposited on 2010-06-12, released 2011-04-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional protein folD
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ngla1, d3ngla2
  • Chain 'C':
    Compound: Bifunctional protein folD
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nglc1, d3nglc2
  • Heterogens: NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nglA (A:)
    mkilrgeeiaekkaenlhgiiersglepslkliqigdneaasiyarakirrgkkigiavd
    lekyddismkdllkriddlakdpqingimienplpkgfdyyeivrnipyykdvdalspyn
    qglialnreflvpatpravidimdyygyhentvtivnrspvvgrplsmmllnrnytvsvc
    hsktkdigsmtrsskivvvavgrpgflnremvtpgsvvidvginyvndkvvgdanfedls
    eyveaitpvpggvgpitatnilenvvkaaefqknnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nglA (A:)
    kilrgeeiaekkaenlhgiiersglepslkliqigdneaasiyarakirrgkkigiavdl
    ekyddismkdllkriddlakdpqingimienplpkgfdyyeivrnipyykdvdalspynq
    glialnreflvpatpravidimdyygyhentvtivnrspvvgrplsmmllnrnytvsvch
    sktkdigsmtrsskivvvavgrpgflnremvtpgsvvidvginyvndkvvgdanfedlse
    yveaitpvpggvgpitatnilenvvkaaefqknnl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3nglC (C:)
    mkilrgeeiaekkaenlhgiiersglepslkliqigdneaasiyarakirrgkkigiavd
    lekyddismkdllkriddlakdpqingimienplpkgfdyyeivrnipyykdvdalspyn
    qglialnreflvpatpravidimdyygyhentvtivnrspvvgrplsmmllnrnytvsvc
    hsktkdigsmtrsskivvvavgrpgflnremvtpgsvvidvginyvndkvvgdanfedls
    eyveaitpvpggvgpitatnilenvvkaaefqknnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nglC (C:)
    kilrgeeiaekkaenlhgiiersglepslkliqigdneaasiyarakirrgkkigiavdl
    ekyddismkdllkriddlakdpqingimienplpkgfdyyeivrnipyykdvdalspynq
    glialnreflvpatpravidimdyygyhentvtivnrspvvgrplsmmllnrnytvsvch
    sktkdigsmtrsskivvvavgrpgflnremvtpgsvvidvginyvndkvvgdanfedlse
    yveaitpvpggvgpitatnilenvvkaaefqknn