PDB entry 3ngj

View 3ngj on RCSB PDB site
Description: Crystal structure of a putative deoxyribose-phosphate aldolase from Entamoeba histolytica
Deposited on 2010-06-11, released 2010-07-21
The last revision was dated 2010-07-21, with a file datestamp of 2010-07-16.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.147
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyribose-phosphate aldolase
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: EHI_121800
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: deoxyribose-phosphate aldolase
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: EHI_121800
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: deoxyribose-phosphate aldolase
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: EHI_121800
    Database cross-references and differences (RAF-indexed):
    • Uniprot C4M5C6 (21-238)
      • expression tag (18-20)
  • Chain 'D':
    Compound: deoxyribose-phosphate aldolase
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: EHI_121800
    Database cross-references and differences (RAF-indexed):
    • Uniprot C4M5C6 (21-238)
      • expression tag (17-20)
  • Heterogens: NA, ZN, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3ngjA (A:)
    mahhhhhhmgtleaqtqgpgsmdkatlakyidhtllkadateeqirklcseaaeykfasv
    cvnptwvplcaellkgtgvkvctvigfplgatpsevkayetkvaveqgaeevdmvinigm
    vkakkyddvekdvkavvdasgkaltkviieccyltneekvevckrcvaagaeyvktstgf
    gthgatpedvklmkdtvgdkalvkaaggirtfddamkminngasrigasagiailngih
    

    Sequence, based on observed residues (ATOM records):
    >3ngjA (A:)
    mdkatlakyidhtllkadateeqirklcseaaeykfasvcvnptwvplcaellkgtgvkv
    ctvigfplgatpsevkayetkvaveqgaeevdmvinigmvkakkyddvekdvkavvdasg
    kaltkviieccyltneekvevckrcvaagaeyvktstgfgthgatpedvklmkdtvgdka
    lvkaaggirtfddamkminngasrigasagiailngih
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3ngjB (B:)
    mahhhhhhmgtleaqtqgpgsmdkatlakyidhtllkadateeqirklcseaaeykfasv
    cvnptwvplcaellkgtgvkvctvigfplgatpsevkayetkvaveqgaeevdmvinigm
    vkakkyddvekdvkavvdasgkaltkviieccyltneekvevckrcvaagaeyvktstgf
    gthgatpedvklmkdtvgdkalvkaaggirtfddamkminngasrigasagiailngih
    

    Sequence, based on observed residues (ATOM records):
    >3ngjB (B:)
    mdkatlakyidhtllkadateeqirklcseaaeykfasvcvnptwvplcaellkgtgvkv
    ctvigfplgatpsevkayetkvaveqgaeevdmvinigmvkakkyddvekdvkavvdasg
    kaltkviieccyltneekvevckrcvaagaeyvktstgfgthgatpedvklmkdtvgdka
    lvkaaggirtfddamkminngasrigasagiailngih
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3ngjC (C:)
    mahhhhhhmgtleaqtqgpgsmdkatlakyidhtllkadateeqirklcseaaeykfasv
    cvnptwvplcaellkgtgvkvctvigfplgatpsevkayetkvaveqgaeevdmvinigm
    vkakkyddvekdvkavvdasgkaltkviieccyltneekvevckrcvaagaeyvktstgf
    gthgatpedvklmkdtvgdkalvkaaggirtfddamkminngasrigasagiailngih
    

    Sequence, based on observed residues (ATOM records):
    >3ngjC (C:)
    pgsmdkatlakyidhtllkadateeqirklcseaaeykfasvcvnptwvplcaellkgtg
    vkvctvigfplgatpsevkayetkvaveqgaeevdmvinigmvkakkyddvekdvkavvd
    asgkaltkviieccyltneekvevckrcvaagaeyvktstgfgthgatpedvklmkdtvg
    dkalvkaaggirtfddamkminngasrigasagiailngih
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3ngjD (D:)
    mahhhhhhmgtleaqtqgpgsmdkatlakyidhtllkadateeqirklcseaaeykfasv
    cvnptwvplcaellkgtgvkvctvigfplgatpsevkayetkvaveqgaeevdmvinigm
    vkakkyddvekdvkavvdasgkaltkviieccyltneekvevckrcvaagaeyvktstgf
    gthgatpedvklmkdtvgdkalvkaaggirtfddamkminngasrigasagiailngih
    

    Sequence, based on observed residues (ATOM records):
    >3ngjD (D:)
    gpgsmdkatlakyidhtllkadateeqirklcseaaeykfasvcvnptwvplcaellkgt
    gvkvctvigfplgatpsevkayetkvaveqgaeevdmvinigmvkakkyddvekdvkavv
    dasgkaltkviieccyltneekvevckrcvaagaeyvktstgfgthgatpedvklmkdtv
    gdkalvkaaggirtfddamkminngasrigasagiailngih