PDB entry 3ngg

View 3ngg on RCSB PDB site
Description: X-ray Structure of Omwaprin
Deposited on 2010-06-11, released 2010-09-08
The last revision was dated 2011-01-05, with a file datestamp of 2010-12-31.
Experiment type: XRAY
Resolution: 1.33 Å
R-factor: 0.176
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Omwaprin-a
    Species: Oxyuranus microlepidotus, synthetic [TaxId:111177]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Omwaprin-a
    Species: Oxyuranus microlepidotus, synthetic [TaxId:111177]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nggA (A:)
    kdrpkkpglcpprpqkpcvkecknddscpgqqkccnygckdecrdpifvg
    

    Sequence, based on observed residues (ATOM records):
    >3nggA (A:)
    kkpglcpprpqkpcvkecknddscpgqqkccnygckdecrdpifvg
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nggB (B:)
    kdrpkkpglcpprpqkpcvkecknddscpgqqkccnygckdecrdpifvg
    

    Sequence, based on observed residues (ATOM records):
    >3nggB (B:)
    rpkkpglcpprpqkpcvkecknddscpgqqkccnygckdecrdpifvg