PDB entry 3ng9

View 3ng9 on RCSB PDB site
Description: Structure to Function Correlations for Adeno-associated Virus Serotype 1
Class: virus
Keywords: Adeno-Associated Virus 1, beta barrel, single-stranded DNA virus, parvovirus, icosahedral virus, Virus
Deposited on 2010-06-11, released 2011-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: capsid protein
    Species: Adeno-associated virus - 1 [TaxId:85106]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ng9a_
  • Chain 'B':
    Compound: capsid protein
    Species: Adeno-associated virus - 1 [TaxId:85106]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ng9b_
  • Chain 'C':
    Compound: capsid protein
    Species: Adeno-associated virus - 1 [TaxId:85106]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ng9c_
  • Chain 'D':
    Compound: capsid protein
    Species: Adeno-associated virus - 1 [TaxId:85106]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ng9d_
  • Chain 'E':
    Compound: capsid protein
    Species: Adeno-associated virus - 1 [TaxId:85106]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ng9e_
  • Chain 'F':
    Compound: capsid protein
    Species: Adeno-associated virus - 1 [TaxId:85106]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ng9f_
  • Chain 'G':
    Compound: capsid protein
    Species: Adeno-associated virus - 1 [TaxId:85106]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ng9g_
  • Chain 'H':
    Compound: capsid protein
    Species: Adeno-associated virus - 1 [TaxId:85106]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ng9h_
  • Chain 'I':
    Compound: capsid protein
    Species: Adeno-associated virus - 1 [TaxId:85106]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ng9i_
  • Chain 'J':
    Compound: capsid protein
    Species: Adeno-associated virus - 1 [TaxId:85106]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ng9j_
  • Heterogens: ADE, CYT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ng9A (A:)
    maadgylpdwlednlsegirewwdlkpgapkpkanqqkqddgrglvlpgykylgpfngld
    kgepvnaadaaalehdkaydqqlkagdnpylrynhadaefqerlqedtsfggnlgravfq
    akkrvleplglveegaktapgkkrpveqspqepdsssgigktgqqpakkrlnfgqtgdse
    svpdpqplgeppatpaavgpttmasgggapmadnnegadgvgnasgnwhcdstwlgdrvi
    ttstrtwalptynnhlykqissastgasndnhyfgystpwgyfdfnrfhchfsprdwqrl
    innnwgfrpkrlnfklfniqvkevttndgvttiannltstvqvfsdseyqlpyvlgsahq
    gclppfpadvfmipqygyltlnngsqavgrssfycleyfpsqmlrtgnnftfsytfeevp
    fhssyahsqsldrlmnplidqylyylnrtqnqsgsaqnkdllfsrgspagmsvqpknwlp
    gpcyrqqrvsktktdnnnsnftwtgaskynlngresiinpgtamashkddedkffpmsgv
    mifgkesagasntaldnvmitdeeeikatnpvaterfgtvavnfqssstdpatgdvhamg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglknpppqilikntpvpanppa
    efsatkfasfitqystgqvsveiewelqkenskrwnpevqytsnyaksanvdftvdnngl
    yteprpigtryltrpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ng9A (A:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfeevpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddedkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnfqssstdpatgdvhamgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglknpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ng9B (B:)
    maadgylpdwlednlsegirewwdlkpgapkpkanqqkqddgrglvlpgykylgpfngld
    kgepvnaadaaalehdkaydqqlkagdnpylrynhadaefqerlqedtsfggnlgravfq
    akkrvleplglveegaktapgkkrpveqspqepdsssgigktgqqpakkrlnfgqtgdse
    svpdpqplgeppatpaavgpttmasgggapmadnnegadgvgnasgnwhcdstwlgdrvi
    ttstrtwalptynnhlykqissastgasndnhyfgystpwgyfdfnrfhchfsprdwqrl
    innnwgfrpkrlnfklfniqvkevttndgvttiannltstvqvfsdseyqlpyvlgsahq
    gclppfpadvfmipqygyltlnngsqavgrssfycleyfpsqmlrtgnnftfsytfeevp
    fhssyahsqsldrlmnplidqylyylnrtqnqsgsaqnkdllfsrgspagmsvqpknwlp
    gpcyrqqrvsktktdnnnsnftwtgaskynlngresiinpgtamashkddedkffpmsgv
    mifgkesagasntaldnvmitdeeeikatnpvaterfgtvavnfqssstdpatgdvhamg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglknpppqilikntpvpanppa
    efsatkfasfitqystgqvsveiewelqkenskrwnpevqytsnyaksanvdftvdnngl
    yteprpigtryltrpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ng9B (B:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfeevpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddedkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnfqssstdpatgdvhamgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglknpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ng9C (C:)
    maadgylpdwlednlsegirewwdlkpgapkpkanqqkqddgrglvlpgykylgpfngld
    kgepvnaadaaalehdkaydqqlkagdnpylrynhadaefqerlqedtsfggnlgravfq
    akkrvleplglveegaktapgkkrpveqspqepdsssgigktgqqpakkrlnfgqtgdse
    svpdpqplgeppatpaavgpttmasgggapmadnnegadgvgnasgnwhcdstwlgdrvi
    ttstrtwalptynnhlykqissastgasndnhyfgystpwgyfdfnrfhchfsprdwqrl
    innnwgfrpkrlnfklfniqvkevttndgvttiannltstvqvfsdseyqlpyvlgsahq
    gclppfpadvfmipqygyltlnngsqavgrssfycleyfpsqmlrtgnnftfsytfeevp
    fhssyahsqsldrlmnplidqylyylnrtqnqsgsaqnkdllfsrgspagmsvqpknwlp
    gpcyrqqrvsktktdnnnsnftwtgaskynlngresiinpgtamashkddedkffpmsgv
    mifgkesagasntaldnvmitdeeeikatnpvaterfgtvavnfqssstdpatgdvhamg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglknpppqilikntpvpanppa
    efsatkfasfitqystgqvsveiewelqkenskrwnpevqytsnyaksanvdftvdnngl
    yteprpigtryltrpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ng9C (C:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfeevpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddedkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnfqssstdpatgdvhamgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglknpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ng9D (D:)
    maadgylpdwlednlsegirewwdlkpgapkpkanqqkqddgrglvlpgykylgpfngld
    kgepvnaadaaalehdkaydqqlkagdnpylrynhadaefqerlqedtsfggnlgravfq
    akkrvleplglveegaktapgkkrpveqspqepdsssgigktgqqpakkrlnfgqtgdse
    svpdpqplgeppatpaavgpttmasgggapmadnnegadgvgnasgnwhcdstwlgdrvi
    ttstrtwalptynnhlykqissastgasndnhyfgystpwgyfdfnrfhchfsprdwqrl
    innnwgfrpkrlnfklfniqvkevttndgvttiannltstvqvfsdseyqlpyvlgsahq
    gclppfpadvfmipqygyltlnngsqavgrssfycleyfpsqmlrtgnnftfsytfeevp
    fhssyahsqsldrlmnplidqylyylnrtqnqsgsaqnkdllfsrgspagmsvqpknwlp
    gpcyrqqrvsktktdnnnsnftwtgaskynlngresiinpgtamashkddedkffpmsgv
    mifgkesagasntaldnvmitdeeeikatnpvaterfgtvavnfqssstdpatgdvhamg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglknpppqilikntpvpanppa
    efsatkfasfitqystgqvsveiewelqkenskrwnpevqytsnyaksanvdftvdnngl
    yteprpigtryltrpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ng9D (D:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfeevpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddedkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnfqssstdpatgdvhamgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglknpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3ng9E (E:)
    maadgylpdwlednlsegirewwdlkpgapkpkanqqkqddgrglvlpgykylgpfngld
    kgepvnaadaaalehdkaydqqlkagdnpylrynhadaefqerlqedtsfggnlgravfq
    akkrvleplglveegaktapgkkrpveqspqepdsssgigktgqqpakkrlnfgqtgdse
    svpdpqplgeppatpaavgpttmasgggapmadnnegadgvgnasgnwhcdstwlgdrvi
    ttstrtwalptynnhlykqissastgasndnhyfgystpwgyfdfnrfhchfsprdwqrl
    innnwgfrpkrlnfklfniqvkevttndgvttiannltstvqvfsdseyqlpyvlgsahq
    gclppfpadvfmipqygyltlnngsqavgrssfycleyfpsqmlrtgnnftfsytfeevp
    fhssyahsqsldrlmnplidqylyylnrtqnqsgsaqnkdllfsrgspagmsvqpknwlp
    gpcyrqqrvsktktdnnnsnftwtgaskynlngresiinpgtamashkddedkffpmsgv
    mifgkesagasntaldnvmitdeeeikatnpvaterfgtvavnfqssstdpatgdvhamg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglknpppqilikntpvpanppa
    efsatkfasfitqystgqvsveiewelqkenskrwnpevqytsnyaksanvdftvdnngl
    yteprpigtryltrpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ng9E (E:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfeevpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddedkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnfqssstdpatgdvhamgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglknpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3ng9F (F:)
    maadgylpdwlednlsegirewwdlkpgapkpkanqqkqddgrglvlpgykylgpfngld
    kgepvnaadaaalehdkaydqqlkagdnpylrynhadaefqerlqedtsfggnlgravfq
    akkrvleplglveegaktapgkkrpveqspqepdsssgigktgqqpakkrlnfgqtgdse
    svpdpqplgeppatpaavgpttmasgggapmadnnegadgvgnasgnwhcdstwlgdrvi
    ttstrtwalptynnhlykqissastgasndnhyfgystpwgyfdfnrfhchfsprdwqrl
    innnwgfrpkrlnfklfniqvkevttndgvttiannltstvqvfsdseyqlpyvlgsahq
    gclppfpadvfmipqygyltlnngsqavgrssfycleyfpsqmlrtgnnftfsytfeevp
    fhssyahsqsldrlmnplidqylyylnrtqnqsgsaqnkdllfsrgspagmsvqpknwlp
    gpcyrqqrvsktktdnnnsnftwtgaskynlngresiinpgtamashkddedkffpmsgv
    mifgkesagasntaldnvmitdeeeikatnpvaterfgtvavnfqssstdpatgdvhamg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglknpppqilikntpvpanppa
    efsatkfasfitqystgqvsveiewelqkenskrwnpevqytsnyaksanvdftvdnngl
    yteprpigtryltrpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ng9F (F:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfeevpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddedkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnfqssstdpatgdvhamgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglknpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3ng9G (G:)
    maadgylpdwlednlsegirewwdlkpgapkpkanqqkqddgrglvlpgykylgpfngld
    kgepvnaadaaalehdkaydqqlkagdnpylrynhadaefqerlqedtsfggnlgravfq
    akkrvleplglveegaktapgkkrpveqspqepdsssgigktgqqpakkrlnfgqtgdse
    svpdpqplgeppatpaavgpttmasgggapmadnnegadgvgnasgnwhcdstwlgdrvi
    ttstrtwalptynnhlykqissastgasndnhyfgystpwgyfdfnrfhchfsprdwqrl
    innnwgfrpkrlnfklfniqvkevttndgvttiannltstvqvfsdseyqlpyvlgsahq
    gclppfpadvfmipqygyltlnngsqavgrssfycleyfpsqmlrtgnnftfsytfeevp
    fhssyahsqsldrlmnplidqylyylnrtqnqsgsaqnkdllfsrgspagmsvqpknwlp
    gpcyrqqrvsktktdnnnsnftwtgaskynlngresiinpgtamashkddedkffpmsgv
    mifgkesagasntaldnvmitdeeeikatnpvaterfgtvavnfqssstdpatgdvhamg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglknpppqilikntpvpanppa
    efsatkfasfitqystgqvsveiewelqkenskrwnpevqytsnyaksanvdftvdnngl
    yteprpigtryltrpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ng9G (G:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfeevpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddedkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnfqssstdpatgdvhamgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglknpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3ng9H (H:)
    maadgylpdwlednlsegirewwdlkpgapkpkanqqkqddgrglvlpgykylgpfngld
    kgepvnaadaaalehdkaydqqlkagdnpylrynhadaefqerlqedtsfggnlgravfq
    akkrvleplglveegaktapgkkrpveqspqepdsssgigktgqqpakkrlnfgqtgdse
    svpdpqplgeppatpaavgpttmasgggapmadnnegadgvgnasgnwhcdstwlgdrvi
    ttstrtwalptynnhlykqissastgasndnhyfgystpwgyfdfnrfhchfsprdwqrl
    innnwgfrpkrlnfklfniqvkevttndgvttiannltstvqvfsdseyqlpyvlgsahq
    gclppfpadvfmipqygyltlnngsqavgrssfycleyfpsqmlrtgnnftfsytfeevp
    fhssyahsqsldrlmnplidqylyylnrtqnqsgsaqnkdllfsrgspagmsvqpknwlp
    gpcyrqqrvsktktdnnnsnftwtgaskynlngresiinpgtamashkddedkffpmsgv
    mifgkesagasntaldnvmitdeeeikatnpvaterfgtvavnfqssstdpatgdvhamg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglknpppqilikntpvpanppa
    efsatkfasfitqystgqvsveiewelqkenskrwnpevqytsnyaksanvdftvdnngl
    yteprpigtryltrpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ng9H (H:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfeevpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddedkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnfqssstdpatgdvhamgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglknpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3ng9I (I:)
    maadgylpdwlednlsegirewwdlkpgapkpkanqqkqddgrglvlpgykylgpfngld
    kgepvnaadaaalehdkaydqqlkagdnpylrynhadaefqerlqedtsfggnlgravfq
    akkrvleplglveegaktapgkkrpveqspqepdsssgigktgqqpakkrlnfgqtgdse
    svpdpqplgeppatpaavgpttmasgggapmadnnegadgvgnasgnwhcdstwlgdrvi
    ttstrtwalptynnhlykqissastgasndnhyfgystpwgyfdfnrfhchfsprdwqrl
    innnwgfrpkrlnfklfniqvkevttndgvttiannltstvqvfsdseyqlpyvlgsahq
    gclppfpadvfmipqygyltlnngsqavgrssfycleyfpsqmlrtgnnftfsytfeevp
    fhssyahsqsldrlmnplidqylyylnrtqnqsgsaqnkdllfsrgspagmsvqpknwlp
    gpcyrqqrvsktktdnnnsnftwtgaskynlngresiinpgtamashkddedkffpmsgv
    mifgkesagasntaldnvmitdeeeikatnpvaterfgtvavnfqssstdpatgdvhamg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglknpppqilikntpvpanppa
    efsatkfasfitqystgqvsveiewelqkenskrwnpevqytsnyaksanvdftvdnngl
    yteprpigtryltrpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ng9I (I:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfeevpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddedkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnfqssstdpatgdvhamgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglknpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3ng9J (J:)
    maadgylpdwlednlsegirewwdlkpgapkpkanqqkqddgrglvlpgykylgpfngld
    kgepvnaadaaalehdkaydqqlkagdnpylrynhadaefqerlqedtsfggnlgravfq
    akkrvleplglveegaktapgkkrpveqspqepdsssgigktgqqpakkrlnfgqtgdse
    svpdpqplgeppatpaavgpttmasgggapmadnnegadgvgnasgnwhcdstwlgdrvi
    ttstrtwalptynnhlykqissastgasndnhyfgystpwgyfdfnrfhchfsprdwqrl
    innnwgfrpkrlnfklfniqvkevttndgvttiannltstvqvfsdseyqlpyvlgsahq
    gclppfpadvfmipqygyltlnngsqavgrssfycleyfpsqmlrtgnnftfsytfeevp
    fhssyahsqsldrlmnplidqylyylnrtqnqsgsaqnkdllfsrgspagmsvqpknwlp
    gpcyrqqrvsktktdnnnsnftwtgaskynlngresiinpgtamashkddedkffpmsgv
    mifgkesagasntaldnvmitdeeeikatnpvaterfgtvavnfqssstdpatgdvhamg
    alpgmvwqdrdvylqgpiwakiphtdghfhpsplmggfglknpppqilikntpvpanppa
    efsatkfasfitqystgqvsveiewelqkenskrwnpevqytsnyaksanvdftvdnngl
    yteprpigtryltrpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ng9J (J:)
    gadgvgnasgnwhcdstwlgdrvittstrtwalptynnhlykqissastgasndnhyfgy
    stpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevttndgvttiann
    ltstvqvfsdseyqlpyvlgsahqgclppfpadvfmipqygyltlnngsqavgrssfycl
    eyfpsqmlrtgnnftfsytfeevpfhssyahsqsldrlmnplidqylyylnrtqnqsgsa
    qnkdllfsrgspagmsvqpknwlpgpcyrqqrvsktktdnnnsnftwtgaskynlngres
    iinpgtamashkddedkffpmsgvmifgkesagasntaldnvmitdeeeikatnpvater
    fgtvavnfqssstdpatgdvhamgalpgmvwqdrdvylqgpiwakiphtdghfhpsplmg
    gfglknpppqilikntpvpanppaefsatkfasfitqystgqvsveiewelqkenskrwn
    pevqytsnyaksanvdftvdnnglyteprpigtryltrpl