PDB entry 3ng7

View 3ng7 on RCSB PDB site
Description: complex of dithionite-reduced 6-hydroxy-l-nicotine oxidase with substrate bound at active site and inhibitor at exit cavity
Deposited on 2010-06-11, released 2011-03-16
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: 6-hydroxy-L-nicotine oxidase
    Species: ARTHROBACTER NICOTINOVORANS [TaxId:29320]
    Gene: 6-HLNO
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93NH4 (0-424)
      • expression tag (425-426)
  • Heterogens: HNL, FAD, GP7, HNK, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'X':
    Sequence, based on SEQRES records:
    >3ng7X (X:)
    mydaivvgggfsglkaardltnagkkvllleggerlggraysresrnvpglrveiggayl
    hrkhhprlaaeldrygiptaaaseftsfrhrlgptavdqafpipgseavaveaatytllr
    dahridlekglenqdledldiplneyvdkldlppvsrqfllawawnmlgqpadqasalwm
    lqlvaahhysilgvvlsldevfsngsadlvdamsqeipeirlqtvvtgidqsgdvvnvtv
    kdghafqahsvivatpmntwrrivftpalperrrsvieeghggqglkilihvrgaeagie
    cvgdgifptlydycevseserllvaftdsgsfdptdigavkdavlyylpevevlgidyhd
    wiadplfegpwvaprvgqfsrvhkelgepagrihfvgsdvslefpgyiegaletaecavn
    ailhshhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3ng7X (X:)
    mydaivvgggfsglkaardltnagkkvllleggerlggraysresrnvpglrveiggayl
    hrkhhprlaaeldrygiptaaaseftsfrhrlgptavdqafpipgseavaveaatytllr
    dahridlekglenqdledldiplneyvdkldlppvsrqfllawawnmlgqpadqasalwm
    lqlvaahhysilgvvlsldevfsngsadlvdamsqeipeirlqtvvtgidqsgdvvnvtv
    kdghafqahsvivatpmntwrrivftpalperrrsvieeghggqglkilihvrgaeagie
    cvgdgifptlydycevseserllvaftdsgsfdptdigavkdavlyylpevevlgidyhd
    wiadplfegpwvaprvgqfsrvhkelgepagrihfvgsdvslefpgyiegaletaecavn
    ailhshh