PDB entry 3ng6

View 3ng6 on RCSB PDB site
Description: The crystal structure of hemoglobin I from Trematomus newnesi in deoxygenated state obtained through an oxidation/reduction cycle in which potassium hexacyanoferrate and sodium dithionite were alternatively added
Class: oxygen transport
Keywords: Root effect, fish hemoglobin, antarctic fish, OXYGEN TRANSPORT
Deposited on 2010-06-11, released 2010-07-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-10-27, with a file datestamp of 2010-10-22.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.195
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemoglobin subunit alpha-1
    Species: Trematomus newnesi [TaxId:35730]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ng6a_
  • Chain 'B':
    Compound: Hemoglobin subunit beta-1/2
    Species: Trematomus newnesi [TaxId:35730]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ng6b_
  • Chain 'C':
    Compound: Hemoglobin subunit alpha-1
    Species: Trematomus newnesi [TaxId:35730]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ng6c_
  • Chain 'D':
    Compound: Hemoglobin subunit beta-1/2
    Species: Trematomus newnesi [TaxId:35730]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ng6d_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ng6A (A:)
    slsdkdkaavralwskigkssdaigndalsrmivvypqtkiyfshwpdvtpgspnikahg
    kkvmggialavskiddlktglmelseqhayklrvdpsnfkilnhcilvvistmfpkeftp
    eahvsldkflsgvalalaeryr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ng6B (B:)
    vewtdkersiisdifshmdyddigpkalsrclvvypwtqryfsgfgnlynaegimsnanv
    aahgikvlhgldrgmknmdniadaytdlstlhseklhvdpdnfkllsdcitivlaakmgh
    aftaetqgafqkflaavvsalgkqyh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ng6C (C:)
    slsdkdkaavralwskigkssdaigndalsrmivvypqtkiyfshwpdvtpgspnikahg
    kkvmggialavskiddlktglmelseqhayklrvdpsnfkilnhcilvvistmfpkeftp
    eahvsldkflsgvalalaeryr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ng6D (D:)
    vewtdkersiisdifshmdyddigpkalsrclvvypwtqryfsgfgnlynaegimsnanv
    aahgikvlhgldrgmknmdniadaytdlstlhseklhvdpdnfkllsdcitivlaakmgh
    aftaetqgafqkflaavvsalgkqyh