PDB entry 3ng5

View 3ng5 on RCSB PDB site
Description: Crystal Structure of V30M transthyretin complexed with (-)-epigallocatechin gallate (EGCG)
Class: transport protein
Keywords: retinol-binding, secreted, thyroid hormone, transport, vitamin a, transport protein, thyroxine
Deposited on 2010-06-11, released 2010-07-07
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-07-07, with a file datestamp of 2010-07-02.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.188
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: PALB, TTR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered mutation (29)
    Domains in SCOPe 2.03: d3ng5a_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: PALB, TTR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered mutation (29)
    Domains in SCOPe 2.03: d3ng5b_
  • Heterogens: KDH, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ng5A (A:)
    gptgtgeskcplmvkvldavrgspainvamhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ng5A (A:)
    kcplmvkvldavrgspainvamhvfrkaaddtwepfasgktsesgelhgltteeefvegi
    ykveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ng5B (B:)
    gptgtgeskcplmvkvldavrgspainvamhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ng5B (B:)
    kcplmvkvldavrgspainvamhvfrkaaddtwepfasgktsesgelhgltteeefvegi
    ykveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn