PDB entry 3ng2

View 3ng2 on RCSB PDB site
Description: Crystal structure of the RNF4 ring domain dimer
Deposited on 2010-06-10, released 2010-10-06
The last revision was dated 2010-10-06, with a file datestamp of 2010-10-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.19
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RING finger protein 4
    Species: Rattus norvegicus [TaxId:10116]
    Gene: RNF4
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: RING finger protein 4
    Species: Rattus norvegicus [TaxId:10116]
    Gene: RNF4
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3ng2A (A:)
    gttglrpsgtvscpicmdgyseivqngrlivstecghvfcsqclrdslknantcptcrkk
    inhkryhpiyi
    

    Sequence, based on observed residues (ATOM records):
    >3ng2A (A:)
    rpsgtvscpicmdgyseivqngrlivstecghvfcsqclrdslknantcptcrkkinhkr
    yhpiyi
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3ng2B (B:)
    gttglrpsgtvscpicmdgyseivqngrlivstecghvfcsqclrdslknantcptcrkk
    inhkryhpiyi
    

    Sequence, based on observed residues (ATOM records):
    >3ng2B (B:)
    lrpsgtvscpicmdgyseivqngrlivstecghvfcsqclrdslknantcptcrkkinhk
    ryhpiyi