PDB entry 3ng1

View 3ng1 on RCSB PDB site
Description: n and gtpase domains of the signal sequence recognition protein ffh from thermus aquaticus
Class: signal recognition
Keywords: ffh, srp, gtpase, signal recognition particle
Deposited on 1998-09-13, released 1999-07-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.199
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: signal sequence recognition protein ffh
    Species: Thermus aquaticus [TaxId:271]
    Gene: FFH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ng1a1, d3ng1a2
  • Chain 'B':
    Compound: signal sequence recognition protein ffh
    Species: Thermus aquaticus [TaxId:271]
    Gene: FFH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ng1b1, d3ng1b2
  • Heterogens: CD, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ng1A (A:)
    mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreeal
    gkqvlesltpaevilatvyealkealggearlpvlkdrnlwflvglqgsgktttaaklal
    yykgkgrrpllvaadtqrpaareqlrllgekvgvpvlevmdgespesirrrveekarlea
    rdlilvdtagrlqideplmgelarlkevlgpdevllvldamtgqealsvarafdekvgvt
    glvltkldgdarggaalsarhvtgkpiyfagvsekpeglepfyperlagrilgm
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ng1B (B:)
    mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreeal
    gkqvlesltpaevilatvyealkealggearlpvlkdrnlwflvglqgsgktttaaklal
    yykgkgrrpllvaadtqrpaareqlrllgekvgvpvlevmdgespesirrrveekarlea
    rdlilvdtagrlqideplmgelarlkevlgpdevllvldamtgqealsvarafdekvgvt
    glvltkldgdarggaalsarhvtgkpiyfagvsekpeglepfyperlagrilgm