PDB entry 3nfy

View 3nfy on RCSB PDB site
Description: The Structure of Human Bisphosphoglycerate Mutase to 1.94A
Class: isomerase
Keywords: homodimer, synthase, phosphatase, mutase, ISOMERASE
Deposited on 2010-06-10, released 2010-11-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-11-10, with a file datestamp of 2010-11-05.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.183
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bisphosphoglycerate mutase
    Species: Homo sapiens [TaxId:9606]
    Gene: BPGM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nfya_
  • Chain 'B':
    Compound: Bisphosphoglycerate mutase
    Species: Homo sapiens [TaxId:9606]
    Gene: BPGM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nfyb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nfyA (A:)
    mskyklimlrhgegawnkenrfcswvdqklnsegmeearncgkqlkalnfefdlvftsvl
    nrsihtawlileelgqewvpvesswrlnerhygaliglnreqmalnhgeeqvrlwrrsyn
    vtpppieeshpyyqeiyndrrykvcdvpldqlprseslkdvlerllpywneriapevlrg
    ktilisahgnssrallkhlegisdediinitlptgvpilleldenlravgphqflgdqea
    iqaaikkvedqgkvkqakklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nfyA (A:)
    skyklimlrhgegawnkenrfcswvdqklnsegmeearncgkqlkalnfefdlvftsvln
    rsihtawlileelgqewvpvesswrlnerhygaliglnreqmalnhgeeqvrlwrrsynv
    tpppieeshpyyqeiyndrrykvcdvpldqlprseslkdvlerllpywneriapevlrgk
    tilisahgnssrallkhlegisdediinitlptgvpilleldenlravgphqflgdqeai
    qaaikkved
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nfyB (B:)
    mskyklimlrhgegawnkenrfcswvdqklnsegmeearncgkqlkalnfefdlvftsvl
    nrsihtawlileelgqewvpvesswrlnerhygaliglnreqmalnhgeeqvrlwrrsyn
    vtpppieeshpyyqeiyndrrykvcdvpldqlprseslkdvlerllpywneriapevlrg
    ktilisahgnssrallkhlegisdediinitlptgvpilleldenlravgphqflgdqea
    iqaaikkvedqgkvkqakklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nfyB (B:)
    skyklimlrhgegawnkenrfcswvdqklnsegmeearncgkqlkalnfefdlvftsvln
    rsihtawlileelgqewvpvesswrlnerhygaliglnreqmalnhgeeqvrlwrrsynv
    tpppieeshpyyqeiyndrrykvcdvpldqlprseslkdvlerllpywneriapevlrgk
    tilisahgnssrallkhlegisdediinitlptgvpilleldenlravgphqflgdqeai
    qaaikkved