PDB entry 3nfw

View 3nfw on RCSB PDB site
Description: Crystal structure of nitrilotriacetate monooxygenase component B (A0R521 homolog) from Mycobacterium thermoresistibile
Class: oxidoreductase
Keywords: Seattle Structural Genomics Center for Infectious Disease, SSGCID, Mycobacterium, tuberculosis, thermoresistible, biodegredation, NADH dependent, oxidoreductase
Deposited on 2010-06-10, released 2010-06-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-22, with a file datestamp of 2015-04-17.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Flavin reductase-like, FMN-binding protein
    Species: Mycobacterium thermoresistibile [TaxId:1078020]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nfwa_
  • Chain 'B':
    Compound: Flavin reductase-like, FMN-binding protein
    Species: Mycobacterium thermoresistibile [TaxId:1078020]
    Database cross-references and differences (RAF-indexed):
    • Uniprot G7CEX2 (23-End)
      • expression tag (22)
    Domains in SCOPe 2.07: d3nfwb1, d3nfwb2
  • Chain 'C':
    Compound: Flavin reductase-like, FMN-binding protein
    Species: Mycobacterium thermoresistibile [TaxId:1078020]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nfwc_
  • Chain 'D':
    Compound: Flavin reductase-like, FMN-binding protein
    Species: Mycobacterium thermoresistibile [TaxId:1078020]
    Database cross-references and differences (RAF-indexed):
    • Uniprot G7CEX2 (23-End)
      • expression tag (22)
    Domains in SCOPe 2.07: d3nfwd1, d3nfwd2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nfwA (A:)
    mahhhhhhmgtleaqtqgpgsmvtaeaidqrtfrrvlgqfctgvtiittvhegnpvgfac
    qsfaalsldpplvlfcptkvsrswkaieasgrfcvnilhekqqhvsarfgsrepdkfagi
    dwrpsdlgspiidgslahidctvhdvhdggdhfvvfgkvhglsevperkprpllfyrgey
    tgiepekntpaqwrddleafltattadtwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nfwA (A:)
    aeaidqrtfrrvlgqfctgvtiittvhegnpvgfacqsfaalsldpplvlfcptkvsrsw
    kaieasgrfcvnilhekqqhvsarfgsrepdkfagidwrpsdlgspiidgslahidctvh
    dvhdggdhfvvfgkvhglsevperkprpllfyrgeytgiepekntpaqwrddleaflta
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nfwB (B:)
    mahhhhhhmgtleaqtqgpgsmvtaeaidqrtfrrvlgqfctgvtiittvhegnpvgfac
    qsfaalsldpplvlfcptkvsrswkaieasgrfcvnilhekqqhvsarfgsrepdkfagi
    dwrpsdlgspiidgslahidctvhdvhdggdhfvvfgkvhglsevperkprpllfyrgey
    tgiepekntpaqwrddleafltattadtwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nfwB (B:)
    vtaeaidqrtfrrvlgqfctgvtiittvhegnpvgfacqsfaalsldpplvlfcptkvsr
    swkaieasgrfcvnilhekqqhvsarfgsrepdkfagidwrpsdlgspiidgslahidct
    vhdvhdggdhfvvfgkvhglsevperkprpllfyrgeytgiepekntpaqwrddleaflt
    at
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3nfwC (C:)
    mahhhhhhmgtleaqtqgpgsmvtaeaidqrtfrrvlgqfctgvtiittvhegnpvgfac
    qsfaalsldpplvlfcptkvsrswkaieasgrfcvnilhekqqhvsarfgsrepdkfagi
    dwrpsdlgspiidgslahidctvhdvhdggdhfvvfgkvhglsevperkprpllfyrgey
    tgiepekntpaqwrddleafltattadtwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nfwC (C:)
    taeaidqrtfrrvlgqfctgvtiittvhegnpvgfacqsfaalsldpplvlfcptkvsrs
    wkaieasgrfcvnilhekqqhvsarfgsrepdkfagidwrpsdlgspiidgslahidctv
    hdvhdggdhfvvfgkvhglsevperkprpllfyrgeytgiepekntpaqwrddleaflta
    t
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3nfwD (D:)
    mahhhhhhmgtleaqtqgpgsmvtaeaidqrtfrrvlgqfctgvtiittvhegnpvgfac
    qsfaalsldpplvlfcptkvsrswkaieasgrfcvnilhekqqhvsarfgsrepdkfagi
    dwrpsdlgspiidgslahidctvhdvhdggdhfvvfgkvhglsevperkprpllfyrgey
    tgiepekntpaqwrddleafltattadtwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nfwD (D:)
    vtaeaidqrtfrrvlgqfctgvtiittvhegnpvgfacqsfaalsldpplvlfcptkvsr
    swkaieasgrfcvnilhekqqhvsarfgsrepdkfagidwrpsdlgspiidgslahidct
    vhdvhdggdhfvvfgkvhglsevperkprpllfyrgeytgiepekntpaqwrddleaflt
    at