PDB entry 3nfv

View 3nfv on RCSB PDB site
Description: crystal structure of an alginate lyase (bacova_01668) from bacteroides ovatus at 1.95 a resolution
Deposited on 2010-06-10, released 2010-07-28
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alginate lyase
    Species: Bacteroides ovatus [TaxId:411476]
    Gene: BACOVA_01668
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7LV19 (1-381)
      • leader sequence (0)
  • Heterogens: IPA, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3nfvA (A:)
    gqvantriyaaeklakvkekadsplyapavktllrdadkalkmtppsvmdktmtadsgdk
    hdymsmgpywwpdpskpdglpyirkdgqrnpeldkldrnklgdmskavttlglayyfsgd
    ekyaqkavdflnvwfldaktkmnphltygqtipgknkgmgrgagmidiysftemidamtl
    menskaftpkvkkgmkewftqlvewmqtspvaaeeqraknnhglaydvqltayalytgnq
    dlamktiqefpekrlfaqiepdgkqplelarttalgytifnlghmldmcsiastlgqdiy
    natsqdgrsitaalkflipyigkpqsewpyqqikewdkkqeeacwilrrasffdpkagye
    aigaqfretpankrihliysle