PDB entry 3nfs

View 3nfs on RCSB PDB site
Description: Crystal structure the Fab fragment of therapeutic antibody daclizumab
Class: immune system
Keywords: IL-2Ra, CD25, Daclizumab, Zenapax, therapeutic antibody, immune system
Deposited on 2010-06-10, released 2010-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-16, with a file datestamp of 2013-10-11.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.227
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Light chain of Fab fragment of daclizumab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NFS (0-215)
  • Chain 'L':
    Compound: Heavy chain of Fab fragment of daclizumab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NFS (0-211)
    Domains in SCOPe 2.07: d3nfsl1, d3nfsl2

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nfsL (L:)
    diqmtqspstlsasvgdrvtitcsasssisymhwyqqkpgkapklliyttsnlasgvpar
    fsgsgsgteftltisslqpddfatyychqrstypltfgqgtkvevkrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrge