PDB entry 3nfq

View 3nfq on RCSB PDB site
Description: Crystal structure of the conserved central domain of yeast Spn1/Iws1
Deposited on 2010-06-10, released 2010-10-13
The last revision was dated 2010-11-17, with a file datestamp of 2010-11-12.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.207
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription factor IWS1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: IWS1, SPN1, YPR133C
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Transcription factor IWS1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: IWS1, SPN1, YPR133C
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nfqA (A:)
    rrtrrdeddleqyldekilrlkdemniaaqldidtlnkrietgdtsliamqkvkllpkvv
    svlskanladtildnnllqsvriwleplpdgslpsfeiqkslfaalndlpvktehlkesg
    lgrvvifytkskrveaqlarlaekliaewtrpiigasdnyrdkrimqlef
    

    Sequence, based on observed residues (ATOM records):
    >3nfqA (A:)
    ddleqyldekilrlkdemniaaqldidtlnkrietgdtsliamqkvkllpkvvsvlskan
    ladtildnnllqsvriwleplpdgslpsfeiqkslfaalndlpvktehlkesglgrvvif
    ytkskrveaqlarlaekliaewtrpii
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nfqB (B:)
    rrtrrdeddleqyldekilrlkdemniaaqldidtlnkrietgdtsliamqkvkllpkvv
    svlskanladtildnnllqsvriwleplpdgslpsfeiqkslfaalndlpvktehlkesg
    lgrvvifytkskrveaqlarlaekliaewtrpiigasdnyrdkrimqlef
    

    Sequence, based on observed residues (ATOM records):
    >3nfqB (B:)
    ddleqyldekilrlkdemniaaqldidtlnkrietgdtsliamqkvkllpkvvsvlskan
    ladtildnnllqsvriwleplpdgslpsfeiqkslfaalndlpvktehlkesglgrvvif
    ytkskrveaqlarlaekliaewt