PDB entry 3nfp

View 3nfp on RCSB PDB site
Description: Crystal structure of the Fab fragment of therapeutic antibody daclizumab in complex with IL-2Ra (CD25) ectodomain
Class: Immune system/Cytokine
Keywords: IL-2Ra, CD25, Daclizumab, Zenapax, therapeutic antibody, immune system, Immune system-Cytokine complex
Deposited on 2010-06-10, released 2010-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-16, with a file datestamp of 2013-10-11.
Experiment type: XRAY
Resolution: 2.86 Å
R-factor: 0.255
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heavy chain of Fab fragment of daclizumab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NFP (0-215)
  • Chain 'B':
    Compound: Light chain of Fab fragment of daclizumab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NFP (0-211)
    Domains in SCOPe 2.07: d3nfpb1, d3nfpb2
  • Chain 'H':
    Compound: Heavy chain of Fab fragment of daclizumab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NFP (0-215)
  • Chain 'I':
    Compound: Interleukin-2 receptor subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: IL2RA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nfpi1, d3nfpi2
  • Chain 'K':
    Compound: Interleukin-2 receptor subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: IL2RA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nfpk1, d3nfpk2
  • Chain 'L':
    Compound: Light chain of Fab fragment of daclizumab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NFP (0-211)
    Domains in SCOPe 2.07: d3nfpl1, d3nfpl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nfpB (B:)
    diqmtqspstlsasvgdrvtitcsasssisymhwyqqkpgkapklliyttsnlasgvpar
    fsgsgsgteftltisslqpddfatyychqrstypltfgqgtkvevkrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3nfpI (I:)
    elcdddppeiphatfkamaykegtmlnceckrgfrriksgslymlctgnsshsswdnqcq
    ctssatrnttkqvtpqpeeqkerkttemqspmqpvdqaslpghcrepppweneateriyh
    fvvgqmvyyqcvqgyralhrgpaesvckmthgktrwtqpqlictgemetsqfpgeekpqa
    spegrpesetsclvtttdfqiqtemaatmetsifttehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nfpI (I:)
    elcdddppeiphatfkamaykegtmlnceckriksgslymlctgnsshsswdnqcqctss
    pghcrepppweneateriyhfvvgqmvyyqcvqgyralhrgpaesvckmthgktrwtqpq
    lict
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3nfpK (K:)
    elcdddppeiphatfkamaykegtmlnceckrgfrriksgslymlctgnsshsswdnqcq
    ctssatrnttkqvtpqpeeqkerkttemqspmqpvdqaslpghcrepppweneateriyh
    fvvgqmvyyqcvqgyralhrgpaesvckmthgktrwtqpqlictgemetsqfpgeekpqa
    spegrpesetsclvtttdfqiqtemaatmetsifttehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nfpK (K:)
    elcdddppeiphatfkamaykegtmlncecriksgslymlctgnsshsswdnqcqctssg
    hcrepppweneateriyhfvvgqmvyyqgyraaesvckmthgktrwtqpql
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nfpL (L:)
    diqmtqspstlsasvgdrvtitcsasssisymhwyqqkpgkapklliyttsnlasgvpar
    fsgsgsgteftltisslqpddfatyychqrstypltfgqgtkvevkrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrge