PDB entry 3nfm

View 3nfm on RCSB PDB site
Description: Crystal Structure of the complex of type I ribosome inactivating protein with fructose at 2.5A resolution
Class: Hydrolase
Keywords: RIP, RNA N-glycosidase, Plant protein, fructose, Hydrolase
Deposited on 2010-06-10, released 2010-06-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-06-30, with a file datestamp of 2010-06-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.22
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribosome inactivating protein
    Species: Momordica balsamina [TaxId:3672]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NFM (0-245)
    Domains in SCOPe 2.05: d3nfma_
  • Heterogens: FRU, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nfmA (A:)
    dvsfrlsgadpssygmfikdlrnalphtekvyniplllpsvsgagryllmhlfnydgnti
    tvavdvtnvyimgylalttsyffnepaadlasqyvfrsarrkitlpysgnyerlqiaagk
    prekipiglpaldtaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
    pssatislenswsglskqiqlaqgnngvfrtptvlvdskgnrvqitnvtsnvvtsniqll
    lntkni