PDB entry 3nfk

View 3nfk on RCSB PDB site
Description: Crystal structure of the PTPN4 PDZ domain complexed with the C-terminus of a rabies virus G protein
Class: protein binding
Keywords: PDZ-PDZ-binding site complex, PROTEIN BINDING
Deposited on 2010-06-10, released 2011-08-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-11-30, with a file datestamp of 2011-11-25.
Experiment type: XRAY
Resolution: 1.43 Å
R-factor: 0.193
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: tyrosine-protein phosphatase non-receptor type 4
  Species: Homo sapiens [TaxId:9606]
  Gene: PTPN4
  Database cross-references and differences (RAF-indexed):
  • Uniprot P29074 (Start-106)
  Domains in SCOPe 2.08: d3nfka_
• Chain 'B':
  Compound: tyrosine-protein phosphatase non-receptor type 4
  Species: Homo sapiens [TaxId:9606]
  Gene: PTPN4
  Database cross-references and differences (RAF-indexed):
  • Uniprot P29074 (Start-106)
  Domains in SCOPe 2.08: d3nfkb_
• Chain 'C':
  Compound: Glycoprotein G
  Species: Rabies virus, synthetic [TaxId:11292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03524 (0-12)
• Chain 'D':
  Compound: Glycoprotein G
  Species: Rabies virus, synthetic [TaxId:11292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03524 (Start-12)
• Heterogens: GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3nfkA (A:)
  gsspekptpnggiphdnlvlirmkpdengrfgfnvkggydqkmpvivsrvapgtpadlcv
  prlnegdqvvlingrdiaehthdqvvlfikascerhsgelmllvrpn
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3nfkA (A:)
  dnlvlirmkpdengrfgfnvkggydqkmpvivsrvapgtpadlcvprlnegdqvvlingr
  diaehthdqvvlfikascerhsgelmllvrpn
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >3nfkB (B:)
  gsspekptpnggiphdnlvlirmkpdengrfgfnvkggydqkmpvivsrvapgtpadlcv
  prlnegdqvvlingrdiaehthdqvvlfikascerhsgelmllvrpn
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3nfkB (B:)
  hdnlvlirmkpdengrfgfnvkggydqkmpvivsrvapgtpadlcvprlnegdqvvling
  rdiaehthdqvvlfikascesgelmllvrpn
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.