PDB entry 3nfh

View 3nfh on RCSB PDB site
Description: Crystal structure of tandem winged helix domain of RNA polymerase I subunit A49 (P4)
Deposited on 2010-06-10, released 2010-09-08
The last revision was dated 2010-09-08, with a file datestamp of 2010-09-03.
Experiment type: XRAY
Resolution: 2.17 Å
R-factor: 0.19
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-directed RNA polymerase I subunit RPA49
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: N0880, RPA49, RRN13, YNL248C
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: DNA-directed RNA polymerase I subunit RPA49
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: N0880, RPA49, RRN13, YNL248C
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nfhA (A:)
    mtdsaidivdsvrtaskdlptraqldeitsndrptplanidatdveqiypiesiipkkel
    qfirvssilkeadkekklelfpyqnnskyvakkldsltqpsqmtklqllyylslllgvye
    nrrvnnktkllerlnsppeilvdgilsrftvikpgqfgrskdrsyfidpqnedkilcyil
    aiimhldnfiveitplahelnlkpskvvslfrvlgaivkgatvaqaeafgipkstaasyk
    iatmkv
    

    Sequence, based on observed residues (ATOM records):
    >3nfhA (A:)
    drptplanidatdveqiypiesiipkkelqfirvssilkeadkekklelfpyqnnskyva
    kkldsltqpsqmtklqllyylslllgvyenrrvnnktkllerlnsppeilvdgilsrftv
    ikprsyfidpqnedkilcyilaiimhldnfiveitplahelnlkpskvvslfrvlgaivk
    gatvaqaeafgipkstaasykiatmkv
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nfhB (B:)
    mtdsaidivdsvrtaskdlptraqldeitsndrptplanidatdveqiypiesiipkkel
    qfirvssilkeadkekklelfpyqnnskyvakkldsltqpsqmtklqllyylslllgvye
    nrrvnnktkllerlnsppeilvdgilsrftvikpgqfgrskdrsyfidpqnedkilcyil
    aiimhldnfiveitplahelnlkpskvvslfrvlgaivkgatvaqaeafgipkstaasyk
    iatmkv
    

    Sequence, based on observed residues (ATOM records):
    >3nfhB (B:)
    qldeitsndrptplanidatdveqiypiesiipkkelqfirvssilkeadkekklelfpy
    qnnskyvakkldsltqpsqmtklqllyylslllgvyenrrvnnktkllerlnsppeilvd
    gilsrftvikpdrsyfidpqnedkilcyilaiimhldnfiveitplahelnlkpskvvsl
    frvlgaivkgatvaqaeafgipkstaasykiatmkv