PDB entry 3nfg

View 3nfg on RCSB PDB site
Description: Crystal structure of Dimerization module of RNA polymerase I subcomplex A49/A34.5
Class: transcription
Keywords: triple barrel, transcription, RNA polymerase, Dimerization
Deposited on 2010-06-10, released 2010-09-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-directed RNA polymerase I subunit RPA49
    Species: Candida glabrata [TaxId:5478]
    Gene: CAGL0J07766g, rpa49
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6FNZ9
      • engineered mutation (74)
    Domains in SCOPe 2.07: d3nfga_
  • Chain 'B':
    Compound: DNA-directed RNA polymerase I subunit RPA34
    Species: Candida glabrata [TaxId:5478]
    Gene: CAGL0I06006g, rpa34
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6FQI3 (4-122)
      • expression tag (3)
      • engineered mutation (34)
    Domains in SCOPe 2.07: d3nfgb1, d3nfgb2
  • Chain 'C':
    Compound: DNA-directed RNA polymerase I subunit RPA49
    Species: Candida glabrata [TaxId:5478]
    Gene: CAGL0J07766g, rpa49
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6FNZ9 (Start-101)
      • engineered mutation (74)
    Domains in SCOPe 2.07: d3nfgc_
  • Chain 'D':
    Compound: DNA-directed RNA polymerase I subunit RPA34
    Species: Candida glabrata [TaxId:5478]
    Gene: CAGL0I06006g, rpa34
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6FQI3 (4-122)
      • expression tag (3)
      • engineered mutation (34)
    Domains in SCOPe 2.07: d3nfgd1, d3nfgd2
  • Chain 'E':
    Compound: DNA-directed RNA polymerase I subunit RPA49
    Species: Candida glabrata [TaxId:5478]
    Gene: CAGL0J07766g, rpa49
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6FNZ9 (Start-101)
      • engineered mutation (74)
    Domains in SCOPe 2.07: d3nfge_
  • Chain 'F':
    Compound: DNA-directed RNA polymerase I subunit RPA34
    Species: Candida glabrata [TaxId:5478]
    Gene: CAGL0I06006g, rpa34
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6FQI3 (4-122)
      • expression tag (3)
      • engineered mutation (34)
    Domains in SCOPe 2.07: d3nfgf1, d3nfgf2
  • Chain 'G':
    Compound: DNA-directed RNA polymerase I subunit RPA49
    Species: Candida glabrata [TaxId:5478]
    Gene: CAGL0J07766g, rpa49
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6FNZ9 (Start-101)
      • engineered mutation (74)
    Domains in SCOPe 2.07: d3nfgg_
  • Chain 'H':
    Compound: DNA-directed RNA polymerase I subunit RPA34
    Species: Candida glabrata [TaxId:5478]
    Gene: CAGL0I06006g, rpa34
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6FQI3 (4-122)
      • expression tag (3)
      • engineered mutation (34)
    Domains in SCOPe 2.07: d3nfgh1, d3nfgh2
  • Chain 'I':
    Compound: DNA-directed RNA polymerase I subunit RPA49
    Species: Candida glabrata [TaxId:5478]
    Gene: CAGL0J07766g, rpa49
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6FNZ9
      • engineered mutation (74)
    Domains in SCOPe 2.07: d3nfgi_
  • Chain 'J':
    Compound: DNA-directed RNA polymerase I subunit RPA34
    Species: Candida glabrata [TaxId:5478]
    Gene: CAGL0I06006g, rpa34
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6FQI3 (4-122)
      • expression tag (3)
      • engineered mutation (34)
    Domains in SCOPe 2.07: d3nfgj1, d3nfgj2
  • Chain 'K':
    Compound: DNA-directed RNA polymerase I subunit RPA49
    Species: Candida glabrata [TaxId:5478]
    Gene: CAGL0J07766g, rpa49
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6FNZ9 (Start-101)
      • engineered mutation (74)
    Domains in SCOPe 2.07: d3nfgk_
  • Chain 'L':
    Compound: DNA-directed RNA polymerase I subunit RPA34
    Species: Candida glabrata [TaxId:5478]
    Gene: CAGL0I06006g, rpa34
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6FQI3 (4-122)
      • expression tag (3)
      • engineered mutation (34)
    Domains in SCOPe 2.07: d3nfgl1, d3nfgl2
  • Chain 'M':
    Compound: DNA-directed RNA polymerase I subunit RPA49
    Species: Candida glabrata [TaxId:5478]
    Gene: CAGL0J07766g, rpa49
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6FNZ9
      • engineered mutation (74)
    Domains in SCOPe 2.07: d3nfgm_
  • Chain 'N':
    Compound: DNA-directed RNA polymerase I subunit RPA34
    Species: Candida glabrata [TaxId:5478]
    Gene: CAGL0I06006g, rpa34
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6FQI3 (4-122)
      • expression tag (3)
      • engineered mutation (34)
    Domains in SCOPe 2.07: d3nfgn1, d3nfgn2
  • Chain 'O':
    Compound: DNA-directed RNA polymerase I subunit RPA49
    Species: Candida glabrata [TaxId:5478]
    Gene: CAGL0J07766g, rpa49
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6FNZ9
      • engineered mutation (74)
    Domains in SCOPe 2.07: d3nfgo_
  • Chain 'P':
    Compound: DNA-directed RNA polymerase I subunit RPA34
    Species: Candida glabrata [TaxId:5478]
    Gene: CAGL0I06006g, rpa34
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6FQI3 (4-122)
      • engineered mutation (34)
    Domains in SCOPe 2.07: d3nfgp_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nfgA (A:)
    gshmgekrsiaidsyqedpsvvvsnffkgvrvpkdtefqlykkrkqdqfvlhgenerley
    dgetdelttktnqymvglydkqsgkinlyrapvvtskivskf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nfgA (A:)
    rsiaidsyqedpsvvvsnffkgvrvpkdtefqlykkrkqdqfvlhgenerleydgetdel
    ttktnqymvglydkqsgkinlyrapvvtskivsk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nfgB (B:)
    mgmgyqppsdykqckhlksfpvselkgdnkelwlmkvpanidisqlkslpldtdatvstv
    elgsknfnvlqntstqegsdntnlsllipsekkketlkvatskdnksvyfdrvftiseta
    rip
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nfgB (B:)
    gyqppsdykqckhlksfpvselkgdnkelwlmkvpanidisqlkslpldtdatvstvelg
    sknfnvlqntstqegsdntnlsllipsekkketlkvatskdnksvyfdrvftisetarip
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3nfgC (C:)
    gshmgekrsiaidsyqedpsvvvsnffkgvrvpkdtefqlykkrkqdqfvlhgenerley
    dgetdelttktnqymvglydkqsgkinlyrapvvtskivskf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nfgC (C:)
    rsiaidsyqedpsvvvsnffkgvrvpkdtefqlykkrkqdqfvlhgenerleydgetdel
    ttktnqymvglydkqsgkinlyrapvvtskivskf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3nfgD (D:)
    mgmgyqppsdykqckhlksfpvselkgdnkelwlmkvpanidisqlkslpldtdatvstv
    elgsknfnvlqntstqegsdntnlsllipsekkketlkvatskdnksvyfdrvftiseta
    rip
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nfgD (D:)
    gyqppsdykqckhlksfpvselkgdnkelwlmkvpanidisqlkslpldtdatvstvelg
    sknfnvlqntstqegsdntnlsllipsekkketlkvatskdnksvyfdrvftisetarip
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3nfgE (E:)
    gshmgekrsiaidsyqedpsvvvsnffkgvrvpkdtefqlykkrkqdqfvlhgenerley
    dgetdelttktnqymvglydkqsgkinlyrapvvtskivskf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nfgE (E:)
    krsiaidsyqedpsvvvsnffkgvrvpkdtefqlykkrkqdqfvlhgenerleydgetde
    lttktnqymvglydkqsgkinlyrapvvtskivskf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3nfgF (F:)
    mgmgyqppsdykqckhlksfpvselkgdnkelwlmkvpanidisqlkslpldtdatvstv
    elgsknfnvlqntstqegsdntnlsllipsekkketlkvatskdnksvyfdrvftiseta
    rip
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nfgF (F:)
    gyqppsdykqckhlksfpvselkgdnkelwlmkvpanidisqlkslpldtdatvstvelg
    sknfnvlqntstqegsdntnlsllipsekkketlkvatskdnksvyfdrvftisetarip
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3nfgG (G:)
    gshmgekrsiaidsyqedpsvvvsnffkgvrvpkdtefqlykkrkqdqfvlhgenerley
    dgetdelttktnqymvglydkqsgkinlyrapvvtskivskf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nfgG (G:)
    rsiaidsyqedpsvvvsnffkgvrvpkdtefqlykkrkqdqfvlhgenerleydgetdel
    ttktnqymvglydkqsgkinlyrapvvtskivskf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3nfgH (H:)
    mgmgyqppsdykqckhlksfpvselkgdnkelwlmkvpanidisqlkslpldtdatvstv
    elgsknfnvlqntstqegsdntnlsllipsekkketlkvatskdnksvyfdrvftiseta
    rip
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nfgH (H:)
    gyqppsdykqckhlksfpvselkgdnkelwlmkvpanidisqlkslpldtdatvstvelg
    sknfnvlqntstqegsdntnlsllipsekkketlkvatskdnksvyfdrvftisetarip
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3nfgI (I:)
    gshmgekrsiaidsyqedpsvvvsnffkgvrvpkdtefqlykkrkqdqfvlhgenerley
    dgetdelttktnqymvglydkqsgkinlyrapvvtskivskf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nfgI (I:)
    rsiaidsyqedpsvvvsnffkgvrvpkdtefqlykkrkqdqfvlhgenerleydgetdel
    ttktnqymvglydkqsgkinlyrapvvtskivsk
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3nfgJ (J:)
    mgmgyqppsdykqckhlksfpvselkgdnkelwlmkvpanidisqlkslpldtdatvstv
    elgsknfnvlqntstqegsdntnlsllipsekkketlkvatskdnksvyfdrvftiseta
    rip
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nfgJ (J:)
    gyqppsdykqckhlksfpvselkgdnkelwlmkvpanidisqlkslpldtdatvstvelg
    sknfnvlqntstqegsdntnlsllipsekkketlkvatskdnksvyfdrvftisetarip
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3nfgK (K:)
    gshmgekrsiaidsyqedpsvvvsnffkgvrvpkdtefqlykkrkqdqfvlhgenerley
    dgetdelttktnqymvglydkqsgkinlyrapvvtskivskf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nfgK (K:)
    rsiaidsyqedpsvvvsnffkgvrvpkdtefqlykkrkqdqfvlhgenerleydgetdel
    ttktnqymvglydkqsgkinlyrapvvtskivskf
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3nfgL (L:)
    mgmgyqppsdykqckhlksfpvselkgdnkelwlmkvpanidisqlkslpldtdatvstv
    elgsknfnvlqntstqegsdntnlsllipsekkketlkvatskdnksvyfdrvftiseta
    rip
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nfgL (L:)
    gyqppsdykqckhlksfpvselkgdnkelwlmkvpanidisqlkslpldtdatvstvelg
    sknfnvlqntstqegsdntnlsllipsekkketlkvatskdnksvyfdrvftisetarip
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3nfgM (M:)
    gshmgekrsiaidsyqedpsvvvsnffkgvrvpkdtefqlykkrkqdqfvlhgenerley
    dgetdelttktnqymvglydkqsgkinlyrapvvtskivskf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nfgM (M:)
    rsiaidsyqedpsvvvsnffkgvrvpkdtefqlykkrkqdqfvlhgenerleydgetdel
    ttktnqymvglydkqsgkinlyrapvvtskivsk
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3nfgN (N:)
    mgmgyqppsdykqckhlksfpvselkgdnkelwlmkvpanidisqlkslpldtdatvstv
    elgsknfnvlqntstqegsdntnlsllipsekkketlkvatskdnksvyfdrvftiseta
    rip
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nfgN (N:)
    gyqppsdykqckhlksfpvselkgdnkelwlmkvpanidisqlkslpldtdatvstvelg
    sknfnvlqntstqegsdntnlsllipsekkketlkvatskdnksvyfdrvftisetarip
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3nfgO (O:)
    gshmgekrsiaidsyqedpsvvvsnffkgvrvpkdtefqlykkrkqdqfvlhgenerley
    dgetdelttktnqymvglydkqsgkinlyrapvvtskivskf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nfgO (O:)
    rsiaidsyqedpsvvvsnffkgvrvpkdtefqlykkrkqdqfvlhgenerleydgetdel
    ttktnqymvglydkqsgkinlyrapvvtskivsk
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3nfgP (P:)
    mgmgyqppsdykqckhlksfpvselkgdnkelwlmkvpanidisqlkslpldtdatvstv
    elgsknfnvlqntstqegsdntnlsllipsekkketlkvatskdnksvyfdrvftiseta
    rip
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nfgP (P:)
    yqppsdykqckhlksfpvselkgdnkelwlmkvpanidisqlkslpldtdatvstvelgs
    knfnvlqntstqegsdntnlsllipsekkketlkvatskdnksvyfdrvftisetarip