PDB entry 3nff

View 3nff on RCSB PDB site
Description: Crystal structure of extended Dimerization module of RNA polymerase I subcomplex A49/A34.5
Class: transcription
Keywords: triple barrel, transcription, RNA polymerase, Dimerization
Deposited on 2010-06-10, released 2010-09-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-12-16, with a file datestamp of 2015-12-11.
Experiment type: XRAY
Resolution: 3.24 Å
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA polymerase I subunit A49
    Species: Candida glabrata [TaxId:5478]
    Gene: CAGL0J07766g, rpa49
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6FNZ9
      • engineered mutation (74)
    Domains in SCOPe 2.07: d3nffa_
  • Chain 'B':
    Compound: RNA polymerase I subunit A34.5
    Species: Candida glabrata [TaxId:5478]
    Gene: CAGL0I06006g, rpa34
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6FQI3 (2-End)
      • engineered mutation (32)
    Domains in SCOPe 2.07: d3nffb_
  • Chain 'C':
    Compound: RNA polymerase I subunit A49
    Species: Candida glabrata [TaxId:5478]
    Gene: CAGL0J07766g, rpa49
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6FNZ9
      • engineered mutation (74)
    Domains in SCOPe 2.07: d3nffc_
  • Chain 'D':
    Compound: RNA polymerase I subunit A34.5
    Species: Candida glabrata [TaxId:5478]
    Gene: CAGL0I06006g, rpa34
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6FQI3 (2-End)
      • engineered mutation (32)
    Domains in SCOPe 2.07: d3nffd_
  • Chain 'E':
    Compound: RNA polymerase I subunit A49
    Species: Candida glabrata [TaxId:5478]
    Gene: CAGL0J07766g, rpa49
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6FNZ9
      • engineered mutation (74)
    Domains in SCOPe 2.07: d3nffe_
  • Chain 'F':
    Compound: RNA polymerase I subunit A34.5
    Species: Candida glabrata [TaxId:5478]
    Gene: CAGL0I06006g, rpa34
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6FQI3 (2-End)
      • engineered mutation (32)
    Domains in SCOPe 2.07: d3nfff_
  • Chain 'G':
    Compound: RNA polymerase I subunit A49
    Species: Candida glabrata [TaxId:5478]
    Gene: CAGL0J07766g, rpa49
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6FNZ9
      • engineered mutation (74)
    Domains in SCOPe 2.07: d3nffg_
  • Chain 'H':
    Compound: RNA polymerase I subunit A34.5
    Species: Candida glabrata [TaxId:5478]
    Gene: CAGL0I06006g, rpa34
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6FQI3 (2-End)
      • engineered mutation (32)
    Domains in SCOPe 2.07: d3nffh_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nffA (A:)
    gshmgekrsiaidsyqedpsvvvsnffkgvrvpkdtefqlykkrkqdqfvlhgenerley
    dgetdelttktnqymvglydkqsgkinlyrapvvtskivskfsknlkgpeikskgdtryg
    am
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nffA (A:)
    siaidsyqedpsvvvsnffkgvrvpkdtefqlykkrkqdqfvlhgenerleydgetdelt
    tktnqymvglydkqsgkinlyrapvvtskivskfsknlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nffB (B:)
    mgyqppsdykqckhlksfpvselkgdnkelwlmkvpanidisqlkslpldtdatvstvel
    gsknfnvlqntstqegsdntnlsllipsekkketlkvatskdnksvyfdrvftisetari
    p
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nffB (B:)
    yqppsdykqckhlksfpvselkgdnkelwlmkvpanidisqlkslpldtdatvstvelgs
    knfnvlqntstqegsdntnlsllipskketlkvatsksvyfdrvftiset
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3nffC (C:)
    gshmgekrsiaidsyqedpsvvvsnffkgvrvpkdtefqlykkrkqdqfvlhgenerley
    dgetdelttktnqymvglydkqsgkinlyrapvvtskivskfsknlkgpeikskgdtryg
    am
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nffC (C:)
    siaidsyqedpsvvvsnffkgvrvpkdtefqlykkrkqdqfvlhgenerleydgetdelt
    tktnqymvglydkqsgkinlyrapvvtskivsk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3nffD (D:)
    mgyqppsdykqckhlksfpvselkgdnkelwlmkvpanidisqlkslpldtdatvstvel
    gsknfnvlqntstqegsdntnlsllipsekkketlkvatskdnksvyfdrvftisetari
    p
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nffD (D:)
    yqppsdykqckhlksfpvselkgdnkelwlmkvpanidisqlkslpldtdatvstvelgs
    knfnvlqntstqegsdntnlsllipskketlkvatsksvyfdrvftiset
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3nffE (E:)
    gshmgekrsiaidsyqedpsvvvsnffkgvrvpkdtefqlykkrkqdqfvlhgenerley
    dgetdelttktnqymvglydkqsgkinlyrapvvtskivskfsknlkgpeikskgdtryg
    am
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nffE (E:)
    siaidsyqedpsvvvsnffkgvrvpkdtefqlykkrkqdqfvlhgenerleydgetdelt
    tktnqymvglydkqsgkinlyrapvvtskivsk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3nffF (F:)
    mgyqppsdykqckhlksfpvselkgdnkelwlmkvpanidisqlkslpldtdatvstvel
    gsknfnvlqntstqegsdntnlsllipsekkketlkvatskdnksvyfdrvftisetari
    p
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nffF (F:)
    yqppsdykqckhlksfpvselkgdnkelwlmkvpanidisqlkslpldtdatvstvelgs
    knfnvlqntstqegsdntnlsllipskketlkvatsksvyfdrvftiset
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3nffG (G:)
    gshmgekrsiaidsyqedpsvvvsnffkgvrvpkdtefqlykkrkqdqfvlhgenerley
    dgetdelttktnqymvglydkqsgkinlyrapvvtskivskfsknlkgpeikskgdtryg
    am
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nffG (G:)
    siaidsyqedpsvvvsnffkgvrvpkdtefqlykkrkqdqfvlhgenerleydgetdelt
    tktnqymvglydkqsgkinlyrapvvtskivsk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3nffH (H:)
    mgyqppsdykqckhlksfpvselkgdnkelwlmkvpanidisqlkslpldtdatvstvel
    gsknfnvlqntstqegsdntnlsllipsekkketlkvatskdnksvyfdrvftisetari
    p
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nffH (H:)
    yqppsdykqckhlksfpvselkgdnkelwlmkvpanidisqlkslpldtdatvstvelgs
    knfnvlqntstqegsdntnlsllipskketlkvatsksvyfdrvftiseta