PDB entry 3nfb

View 3nfb on RCSB PDB site
Description: Crystal structure of the N-terminal beta-aminopeptidase BapA in complex with hydrolyzed ampicillin
Class: Hydrolase/Inhibitor
Keywords: Ntn-hydrolase, alpha-beta-beta-alpha sandwich, beta-peptide cleaving enzyme, Hydrolase-Inhibitor complex
Deposited on 2010-06-10, released 2011-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-09-28, with a file datestamp of 2011-09-23.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.151
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-peptidyl aminopeptidase
    Species: Sphingosinicella xenopeptidilytica [TaxId:364098]
    Gene: bapA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nfba_
  • Chain 'B':
    Compound: Beta-peptidyl aminopeptidase
    Species: Sphingosinicella xenopeptidilytica [TaxId:364098]
    Gene: bapA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nfbb_
  • Chain 'C':
    Compound: Beta-peptidyl aminopeptidase
    Species: Sphingosinicella xenopeptidilytica [TaxId:364098]
    Gene: bapA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nfbc_
  • Chain 'D':
    Compound: Beta-peptidyl aminopeptidase
    Species: Sphingosinicella xenopeptidilytica [TaxId:364098]
    Gene: bapA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nfbd_
  • Heterogens: GOL, OAE, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nfbA (A:)
    gprardlgvpfegtpgalnaitdvagvevghttvisgdgamvigkgpyrtgvtiihplgk
    tsldgvaagravingtgewtgmhlvdevgqflgpialtgtgnvglvhqsmmdwsvgkvpe
    ealfsrllpvvaetldnrlndvfghgltrdhvfaaldgakggpvaegnvgggtgmiaytf
    kggigtssrvvsagdtrytvgvlvqanhgdrndlriagvqigkeikgawpevngivaagp
    dagkpqdknslliviatdaplmphqlermarraalgvgrngstagalsgefalafstshv
    iplggkprlpaiindtdsetmnalfrgvvqateealvnqlvasetmtgannakvygiphd
    qlarimkarfprr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nfbA (A:)
    gprardlgvpfegtpgalnaitdvagvevghttvisgdgamvigkgpyrtgvtiihplgk
    tsldgvaagravingtgewtgmhlvdevgqflgpialtgtgnvglvhqsmmdwsvgkvpe
    ealfsrllpvvaetldnrlndvfghgltrdhvfaaldgakggpvaegnvgggtgmiaytf
    kggigtssrvvsagdtrytvgvlvqanhgdrndlriagvqigkeikgawpevngivaagp
    dagkpslliviatdaplmphqlermarraalgvgrngstagalsgefalafstshviplg
    gkprlpaiindtdsetmnalfrgvvqateealvnqlvasetmtgannakvygiphdqlar
    imkarfp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nfbB (B:)
    gprardlgvpfegtpgalnaitdvagvevghttvisgdgamvigkgpyrtgvtiihplgk
    tsldgvaagravingtgewtgmhlvdevgqflgpialtgtgnvglvhqsmmdwsvgkvpe
    ealfsrllpvvaetldnrlndvfghgltrdhvfaaldgakggpvaegnvgggtgmiaytf
    kggigtssrvvsagdtrytvgvlvqanhgdrndlriagvqigkeikgawpevngivaagp
    dagkpqdknslliviatdaplmphqlermarraalgvgrngstagalsgefalafstshv
    iplggkprlpaiindtdsetmnalfrgvvqateealvnqlvasetmtgannakvygiphd
    qlarimkarfprr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nfbB (B:)
    gprardlgvpfegtpgalnaitdvagvevghttvisgdgamvigkgpyrtgvtiihplgk
    tsldgvaagravingtgewtgmhlvdevgqflgpialtgtgnvglvhqsmmdwsvgkvpe
    ealfsrllpvvaetldnrlndvfghgltrdhvfaaldgakggpvaegnvgggtgmiaytf
    kggigtssrvvsagdtrytvgvlvqanhgdrndlriagvqigkeikgawpevngivaagp
    daslliviatdaplmphqlermarraalgvgrngstagalsgefalafstshviplggkp
    rlpaiindtdsetmnalfrgvvqateealvnqlvasetmtgannakvygiphdqlarimk
    arfp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3nfbC (C:)
    gprardlgvpfegtpgalnaitdvagvevghttvisgdgamvigkgpyrtgvtiihplgk
    tsldgvaagravingtgewtgmhlvdevgqflgpialtgtgnvglvhqsmmdwsvgkvpe
    ealfsrllpvvaetldnrlndvfghgltrdhvfaaldgakggpvaegnvgggtgmiaytf
    kggigtssrvvsagdtrytvgvlvqanhgdrndlriagvqigkeikgawpevngivaagp
    dagkpqdknslliviatdaplmphqlermarraalgvgrngstagalsgefalafstshv
    iplggkprlpaiindtdsetmnalfrgvvqateealvnqlvasetmtgannakvygiphd
    qlarimkarfprr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nfbC (C:)
    gprardlgvpfegtpgalnaitdvagvevghttvisgdgamvigkgpyrtgvtiihplgk
    tsldgvaagravingtgewtgmhlvdevgqflgpialtgtgnvglvhqsmmdwsvgkvpe
    ealfsrllpvvaetldnrlndvfghgltrdhvfaaldgakggpvaegnvgggtgmiaytf
    kggigtssrvvsagdtrytvgvlvqanhgdrndlriagvqigkeikgawpevngivaagp
    dagkslliviatdaplmphqlermarraalgvgrngstagalsgefalafstshviplgg
    kprlpaiindtdsetmnalfrgvvqateealvnqlvasetmtgannakvygiphdqlari
    mkarfp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3nfbD (D:)
    gprardlgvpfegtpgalnaitdvagvevghttvisgdgamvigkgpyrtgvtiihplgk
    tsldgvaagravingtgewtgmhlvdevgqflgpialtgtgnvglvhqsmmdwsvgkvpe
    ealfsrllpvvaetldnrlndvfghgltrdhvfaaldgakggpvaegnvgggtgmiaytf
    kggigtssrvvsagdtrytvgvlvqanhgdrndlriagvqigkeikgawpevngivaagp
    dagkpqdknslliviatdaplmphqlermarraalgvgrngstagalsgefalafstshv
    iplggkprlpaiindtdsetmnalfrgvvqateealvnqlvasetmtgannakvygiphd
    qlarimkarfprr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nfbD (D:)
    gprardlgvpfegtpgalnaitdvagvevghttvisgdgamvigkgpyrtgvtiihplgk
    tsldgvaagravingtgewtgmhlvdevgqflgpialtgtgnvglvhqsmmdwsvgkvpe
    ealfsrllpvvaetldnrlndvfghgltrdhvfaaldgakggpvaegnvgggtgmiaytf
    kggigtssrvvsagdtrytvgvlvqanhgdrndlriagvqigkeikgawpevivaagpda
    gkslliviatdaplmphqlermarraalgvgrngstagalsgefalafstshviplggkp
    rlpaiindtdsetmnalfrgvvqateealvnqlvasetmtgannakvygiphdqlarimk
    arfp