PDB entry 3nf1

View 3nf1 on RCSB PDB site
Description: crystal structure of the tpr domain of kinesin light chain 1
Deposited on 2010-06-09, released 2011-05-25
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kinesin light chain 1
    Species: Homo sapiens [TaxId:9606]
    Gene: KLC1, KLC, KNS2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07866 (16-End)
      • expression tag (4-15)
      • conflict (17)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nf1A (A:)
    mhhhhhhssgrenlyfqgggyeiparlrtlhnlviqyasqgryevavplckqaledlekt
    sghdhpdvatmlnilalvyrdqnkykdaanllndalairektlgkdhpavaatlnnlavl
    ygkrgkykeaeplckraleirekvlgkdhpdvakqlnnlallcqnqgkyeeveyyyqral
    eiyqtklgpddpnvaktknnlascylkqgkfkqaetlykeiltraherefgsvddenkpi
    wmhaeereeckgkqkdgtsfgeyggwykackvdsptvtttlknlgalyrrqgkfeaaetl
    eeaamrsrkqg
    

    Sequence, based on observed residues (ATOM records):
    >3nf1A (A:)
    hhhssgrenlyfqgggyeiparlrtlhnlviqyasqgryevavplckqaledlektsghd
    hpdvatmlnilalvyrdqnkykdaanllndalairektlgkdhpavaatlnnlavlygkr
    gkykeaeplckraleirekvlgkdhpdvakqlnnlallcqnqgkyeeveyyyqraleiyq
    tklgpddpnvaktknnlascylkqgkfkqaetlykeiltraherefgkpiwmhaeereec
    tsfgeygsptvtttlknlgalyrrqgkfeaaetleeaamrsrk