PDB entry 3nf0

View 3nf0 on RCSB PDB site
Description: mPlum-TTN
Class: fluorescent protein
Keywords: mPlum, mCherry, RFPs, FLUORESCENT PROTEIN
Deposited on 2010-06-09, released 2010-10-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fluorescent protein plum
    Species: Discosoma sp. LW-2004 [TaxId:301246]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5S3G7 (Start-233)
      • chromophore (75)
      • engineered mutation (205)
      • engineered mutation (225)
    Domains in SCOPe 2.07: d3nf0a_
  • Heterogens: MLT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nf0A (A:)
    mghhhhhhgvskgeevikefmrfkehmegsvnghefeiegegegrpyegtqtarlkvtkg
    gplpfawdilspqimygskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqds
    slqdgefiykvkvrgtnfpsdgpvmqkktmgweassermypedgalkgemkmrlrlkdgg
    hydaevkttymakkpvqlpgayktdtklditshnedytiveqyernegrhstga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nf0A (A:)
    evikefmrfkehmegsvnghefeiegegegrpyegtqtarlkvtkggplpfawdilspqi
    mygskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqdsslqdgefiykvkvr
    gtnfpsdgpvmqkktmgweassermypedgalkgemkmrlrlkdgghydaevkttymakk
    pvqlpgayktdtklditshnedytiveqyernegrhstga