PDB entry 3nex

View 3nex on RCSB PDB site
Description: V30M mutant human transthyretin (TTR) complexed with GC-24 (V30M:GC-24)
Class: Transport Protein
Keywords: transport protein, ttr,transthyretin, amyloid, gc-1, gc-24
Deposited on 2010-06-09, released 2010-11-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-03-02, with a file datestamp of 2011-02-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.164
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: PALB, TTR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766 (0-115)
      • engineered mutation (20)
    Domains in SCOPe 2.06: d3nexa_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: PALB, TTR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766 (0-115)
      • engineered mutation (20)
    Domains in SCOPe 2.06: d3nexb_
  • Heterogens: GOL, G24, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nexA (A:)
    cplmvkvldavrgspainvamhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nexB (B:)
    cplmvkvldavrgspainvamhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp