PDB entry 3nev

View 3nev on RCSB PDB site
Description: Crystal structure of YagE, a prophage protein from E. coli K12 in complex with KDGal
Class: lyase
Keywords: TIM Barrel, Protein-Ligand Complex, Aldolase, LYASE
Deposited on 2010-06-09, released 2011-04-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-04-13, with a file datestamp of 2011-04-08.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: 0.199
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein yagE
    Species: Escherichia coli [TaxId:83333]
    Gene: b0268, JW0261, yagE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3neva_
  • Chain 'B':
    Compound: Uncharacterized protein yagE
    Species: Escherichia coli [TaxId:83333]
    Gene: b0268, JW0261, yagE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3nevb_
  • Chain 'C':
    Compound: Uncharacterized protein yagE
    Species: Escherichia coli [TaxId:83333]
    Gene: b0268, JW0261, yagE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3nevc_
  • Chain 'D':
    Compound: Uncharacterized protein yagE
    Species: Escherichia coli [TaxId:83333]
    Gene: b0268, JW0261, yagE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3nevd_
  • Heterogens: EDO, RSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nevA (A:)
    alftgiippvstiftadgqldkpgtaaliddlikagvdglfflgsggefsqlgaeerkai
    arfaidhvdrrvpvligtggtnaretielsqhaqqagadgivvinpyywkvseanliryf
    eqvadsvtlpvmlynfpaltgqdltpalvktladsrsniigikdtidsvahlrsmihtvk
    gahphftvlcgyddhlfntlllggdgaisasgnfapqvsvnllkawrdgdvakaagyhqt
    llqipqmyqldtpfvnvikeaivlcgrpvsthvlppaspldeprkaqlktllqqlklc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nevB (B:)
    alftgiippvstiftadgqldkpgtaaliddlikagvdglfflgsggefsqlgaeerkai
    arfaidhvdrrvpvligtggtnaretielsqhaqqagadgivvinpyywkvseanliryf
    eqvadsvtlpvmlynfpaltgqdltpalvktladsrsniigikdtidsvahlrsmihtvk
    gahphftvlcgyddhlfntlllggdgaisasgnfapqvsvnllkawrdgdvakaagyhqt
    llqipqmyqldtpfvnvikeaivlcgrpvsthvlppaspldeprkaqlktllqqlklc
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nevC (C:)
    alftgiippvstiftadgqldkpgtaaliddlikagvdglfflgsggefsqlgaeerkai
    arfaidhvdrrvpvligtggtnaretielsqhaqqagadgivvinpyywkvseanliryf
    eqvadsvtlpvmlynfpaltgqdltpalvktladsrsniigikdtidsvahlrsmihtvk
    gahphftvlcgyddhlfntlllggdgaisasgnfapqvsvnllkawrdgdvakaagyhqt
    llqipqmyqldtpfvnvikeaivlcgrpvsthvlppaspldeprkaqlktllqqlklc
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nevD (D:)
    alftgiippvstiftadgqldkpgtaaliddlikagvdglfflgsggefsqlgaeerkai
    arfaidhvdrrvpvligtggtnaretielsqhaqqagadgivvinpyywkvseanliryf
    eqvadsvtlpvmlynfpaltgqdltpalvktladsrsniigikdtidsvahlrsmihtvk
    gahphftvlcgyddhlfntlllggdgaisasgnfapqvsvnllkawrdgdvakaagyhqt
    llqipqmyqldtpfvnvikeaivlcgrpvsthvlppaspldeprkaqlktllqqlklc