PDB entry 3net

View 3net on RCSB PDB site
Description: crystal structure of histidyl-trna synthetase from nostoc sp. pcc 7120
Deposited on 2010-06-09, released 2010-08-04
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histidyl-tRNA synthetase
    Species: Nostoc sp. PCC 7120 [TaxId:103690]
    Gene: hisS, all5012
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: histidyl-tRNA synthetase
    Species: Nostoc sp. PCC 7120 [TaxId:103690]
    Gene: hisS, all5012
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ACT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3netA (A:)
    snamakndkinfstpsgfpeflpsekrlelylldtirrvyesygftpietpaverlevlq
    akgnqgdniiyglepilppnrqaekdksgdtgsearalkfdqtvplaayiarhlndltfp
    faryqmdvvfrgerakdgrfrqfrqcdidvvgreklsllydaqmpaiiteifeavnigdf
    virinnrkvltgffqslnisetqikscisiidnlekigeakvklelekeginpeqtqkii
    dfvkidgsvddvldklkhlsqtlpeseqfnlgvseletvitgvrnlgvpdkrfcidlaia
    rglnyytgtvyettlighealgsicsggryeelvgtfigekmpgvgisigltrlisrllk
    agilntlpptpaqvvvvnmqdelmptylkvsqqlrqaglnvitnfekrqlgkqfqaadkq
    girfcviigadeaaaqksslkdlqsgeqvevaladlaeeikrrlt
    

    Sequence, based on observed residues (ATOM records):
    >3netA (A:)
    kinfstpsgfpeflpsekrlelylldtirrvyesygftpietpaverlevlqakgnqnii
    yglepilearalkfdqtvplaayiarhlndltfpfaryqmdvvfrgefrqfrqcdidvvg
    reklsllydaqmpaiiteifeavnigdfvirinnrkvltgffqslnisetqikscisiid
    nlekigeakvklelekeginpeqtqkiidfvkidgsvddvldklkhlsqtlpeseqfnlg
    vseletvitgvrnlgvpdkrfcidlaiarglnyytgtvyettlighealgsicsggryee
    lvgtfigekmpgvgisigltrlisrllkagilntlpptpaqvvvvnmqdelmptylkvsq
    qlrqaglnvitnfekrqlgkqfqaadkqgirfcviigadeaaaqksslkdlqsgeqveva
    adlaeeikrrl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3netB (B:)
    snamakndkinfstpsgfpeflpsekrlelylldtirrvyesygftpietpaverlevlq
    akgnqgdniiyglepilppnrqaekdksgdtgsearalkfdqtvplaayiarhlndltfp
    faryqmdvvfrgerakdgrfrqfrqcdidvvgreklsllydaqmpaiiteifeavnigdf
    virinnrkvltgffqslnisetqikscisiidnlekigeakvklelekeginpeqtqkii
    dfvkidgsvddvldklkhlsqtlpeseqfnlgvseletvitgvrnlgvpdkrfcidlaia
    rglnyytgtvyettlighealgsicsggryeelvgtfigekmpgvgisigltrlisrllk
    agilntlpptpaqvvvvnmqdelmptylkvsqqlrqaglnvitnfekrqlgkqfqaadkq
    girfcviigadeaaaqksslkdlqsgeqvevaladlaeeikrrlt
    

    Sequence, based on observed residues (ATOM records):
    >3netB (B:)
    nfstpsgfpeflpsekrlelylldtirrvyesygftpietpaverlevlqakgnqdniiy
    glepilearalkfdqtvplaayiarhlndltfpfaryqmdvvfrgerfrqfrqcdidvvg
    reklsllydaqmpaiiteifeavnigdfvirinnrkvltgffqslnisetqikscisiid
    nlevkleleketqkiidfvkidgsvddvldklkhlsqtlseqfnlgvseletvitgvrnl
    gvpdkrfcidlaiayytgtvyettlighealgsicsggryeelvgtfigekmpgvgisig
    ltrlisrllkagilntlpptpaqvvvvnmqdelmptylkvsqqlrqaglnvitnfekrql
    gkqfqaadkqgirfcviigadeaaaqksslkdlqsgeqvevaladlaeeikrrlt