PDB entry 3neq

View 3neq on RCSB PDB site
Description: crystal structure of the chimeric muscarinic toxin mt7 with loop 3 from mt1
Deposited on 2010-06-09, released 2011-08-24
The last revision was dated 2017-05-31, with a file datestamp of 2017-05-26.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: N/A
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Three-finger muscarinic toxin 7
    Species: DENDROASPIS ANGUSTICEPS, synthetic [TaxId:8618]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Three-finger muscarinic toxin 7
    Species: DENDROASPIS ANGUSTICEPS, synthetic [TaxId:8618]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3neqA (A:)
    ltcvksnsiwfptsedcpdgqnlcfkrwqyisprmydftrgcaatcpkptnvretirccg
    tdkcnk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3neqB (B:)
    ltcvksnsiwfptsedcpdgqnlcfkrwqyisprmydftrgcaatcpkptnvretirccg
    tdkcnk