PDB entry 3nep

View 3nep on RCSB PDB site
Description: 1.55A resolution structure of malate dehydrogenase from Salinibacter ruber
Class: oxidoreductase
Keywords: Malate dehydrogenase, halophile, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle
Deposited on 2010-06-09, released 2010-10-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.169
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: malate dehydrogenase
    Species: Salinibacter ruber [TaxId:309807]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nepx1, d3nepx2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3nepX (X:)
    mkvtvigagnvgatvaecvarqdvakevvmvdikdgmpqgkaldmresspihgfdtrvtg
    tndygptedsdvciitaglprspgmsrddllaknteivggvteqfvegspdstiivvanp
    ldvmtyvayeasgfptnrvmgmagvldtgrfrsfiaeeldvsvrdvqallmgghgdtmvp
    lpryttvggipvpqliddarieeivertkgaggeivdlmgtsawyapgaaaaemteailk
    dnkrilpcaaycdgeyglddlfigvpvklgaggveevievdldadekaqlktsaghvhsn
    lddlqrlrdegkig
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nepX (X:)
    mkvtvigagnvgatvaecvarqdvakevvmvdikdgmpqgkaldmresspihgfdtrvtg
    tndygptedsdvciitaglrddllaknteivggvteqfvegspdstiivvanpldvmtyv
    ayeasgfptnrvmgmagvldtgrfrsfiaeeldvsvrdvqallmgghgdtmvplpryttv
    ggipvpqliddarieeivertkgaggeivdlmgtsawyapgaaaaemteailkdnkrilp
    caaycdgeyglddlfigvpvklgaggveevievdldadekaqlktsaghvhsnlddlqrl
    rdegk