PDB entry 3neo

View 3neo on RCSB PDB site
Description: Wild type human transthyretin (TTR) complexed with GC-24 (TTRwt:GC-24)
Class: Transport Protein
Keywords: transport protein, ttr,transthyretin, amyloid,gc-24
Deposited on 2010-06-09, released 2010-11-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-03-02, with a file datestamp of 2011-02-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.185
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: PALB, TTR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3neoa_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: PALB, TTR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3neob_
  • Heterogens: G24, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3neoA (A:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3neoB (B:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3neoB (B:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsrrytiaallspysysttavvtnp