PDB entry 3nem

View 3nem on RCSB PDB site
Description: Aspartyl-tRNA synthetase complexed with aspartyl adenylate
Class: ligase
Keywords: Rossmann Fold, OB Fold, LIGASE
Deposited on 2010-06-09, released 2010-08-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-08-04, with a file datestamp of 2010-07-30.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.188
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ASPARTYL-tRNA SYNTHETASE
    Species: Thermococcus kodakarensis [TaxId:311400]
    Gene: aspS, TK0492
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nema1, d3nema2
  • Chain 'B':
    Compound: ASPARTYL-tRNA SYNTHETASE
    Species: Thermococcus kodakarensis [TaxId:311400]
    Gene: aspS, TK0492
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nemb1, d3nemb2
  • Heterogens: AMO, ATP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nemA (A:)
    myrthysseiteelngqkvkvagwvwevkdlggikflwirdrdgivqitapkkkvdpelf
    klipklrsedvvavegvvnftpkaklgfeilpekivvlnraetplpldptgkvkaeldtr
    ldnrfmdlrrpevmaifkirssvfkavrdffhengfieihtpkiiatateggtelfpmky
    feedaflaqspqlykqimmasgldrvyeiapifraeehnttrhlneawsidsemafiede
    eevmsflerlvahainyvrehnakeldilnfeleepklpfprvsydkaleilgdlgkeip
    wgedidtegerllgkymmenenaplyflyqypseakpfyimkydnkpeicrafdleyrgv
    eissggqrehrhdilveqikekglnpesfefylkafrygmpphggfglgaerlikqmldl
    pnirevilfprdrrrltp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nemB (B:)
    myrthysseiteelngqkvkvagwvwevkdlggikflwirdrdgivqitapkkkvdpelf
    klipklrsedvvavegvvnftpkaklgfeilpekivvlnraetplpldptgkvkaeldtr
    ldnrfmdlrrpevmaifkirssvfkavrdffhengfieihtpkiiatateggtelfpmky
    feedaflaqspqlykqimmasgldrvyeiapifraeehnttrhlneawsidsemafiede
    eevmsflerlvahainyvrehnakeldilnfeleepklpfprvsydkaleilgdlgkeip
    wgedidtegerllgkymmenenaplyflyqypseakpfyimkydnkpeicrafdleyrgv
    eissggqrehrhdilveqikekglnpesfefylkafrygmpphggfglgaerlikqmldl
    pnirevilfprdrrrltp