PDB entry 3nej

View 3nej on RCSB PDB site
Description: Q28E mutant of Hera RNA helicase N-terminal domain - perfectly twinned hexagonal form
Class: hydrolase
Keywords: RNA helicase, ribosome biogenesis, thermophilic, hydrolase, ATPase
Deposited on 2010-06-09, released 2011-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.57 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heat resistant RNA dependent ATPase
    Species: Thermus thermophilus [TaxId:262724]
    Gene: TT_C1895
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q72GF3 (0-206)
      • engineered mutation (27)
    Domains in SCOPe 2.07: d3neja_
  • Chain 'B':
    Compound: heat resistant RNA dependent ATPase
    Species: Thermus thermophilus [TaxId:262724]
    Gene: TT_C1895
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q72GF3 (0-206)
      • engineered mutation (27)
    Domains in SCOPe 2.07: d3nejb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nejA (A:)
    mefkdfplkpeilealhgrglttptpieaaalplalegkdligqartgtgktlafalpia
    erlapsqergrkpralvltptrelalqvaseltavaphlkvvavyggtgygkqkeallrg
    adavvatpgraldylrqgvldlsrvevavldeademlsmgfeeeveallsatppsrqtll
    fsatlpswakrlaerymknpvlinvik
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nejA (A:)
    mefkdfplkpeilealhgrglttptpieaaalplalegkdligqartgtgktlafalpia
    erlapsqergrkpralvltpqvaseltavaphlkvvavyggtgygkqkeallrgadavva
    tpgraldylrqgvldlsrvevavldeademlsmgfeeeveallsatppsrqtllfsatlp
    swakrlaerymknpvlinvik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nejB (B:)
    mefkdfplkpeilealhgrglttptpieaaalplalegkdligqartgtgktlafalpia
    erlapsqergrkpralvltptrelalqvaseltavaphlkvvavyggtgygkqkeallrg
    adavvatpgraldylrqgvldlsrvevavldeademlsmgfeeeveallsatppsrqtll
    fsatlpswakrlaerymknpvlinvik
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nejB (B:)
    mefkdfplkpeilealhgrglttptpieaaalplalegkdligqartgktlafalpiaer
    lapsqergrkpralvltptrelalqvaseltavaphlkvvavyggtgygkqkeallrgad
    avvatpgraldylrqgvldlsrvevavldeademlsmgfeeeveallsatppsrqtllfs
    atlpswakrlaerymknpvlinvik