PDB entry 3neh

View 3neh on RCSB PDB site
Description: Crystal structure of the protein LMO2462 from Listeria monocytogenes complexed with ZN and phosphonate mimic of dipeptide L-Leu-D-Ala
Deposited on 2010-06-08, released 2010-06-30
The last revision was dated 2010-06-30, with a file datestamp of 2010-06-25.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: 0.198
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Renal dipeptidase family protein
    Species: Listeria monocytogenes [TaxId:265669]
    Gene: LMOf2365_2435
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q71WW4 (3-309)
      • expression tag (1-2)
  • Chain 'B':
    Compound: Renal dipeptidase family protein
    Species: Listeria monocytogenes [TaxId:265669]
    Gene: LMOf2365_2435
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q71WW4 (3-309)
      • expression tag (1-2)
  • Heterogens: L3A, ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nehA (A:)
    mslrvidthcdalyklqagkgkytfqdaeeldvnferlieakmllqgfaifldedipveh
    kwkkaveqvnifkqhvlhkggiihhvkkwcdlenlpedkigamltlegiepigrdldklt
    qlldggvlsvgltwnnanlaadgimeergagltrfgkdiihllnerkvftdvshlsvkaf
    wetleqaefviashsnakaicshprnlddeqikamiehdamihvvfyplfttnngvadte
    dvirhidhicelgglknigfgsdfdgipdhvkglehvgkyqsfletlekhytkeeiegfa
    srnflnhlpkeghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nehA (A:)
    slrvidthcdalyklqagkgkytfqdaeeldvnferlieakmllqgfaifldedipvehk
    wkkaveqvnifkqhvlhkggiihhvkkwcdlenlpedkigamltlegiepigrdldkltq
    lldggvlsvgltwnnanlaadgimeergagltrfgkdiihllnerkvftdvshlsvkafw
    etleqaefviashsnakaicshprnlddeqikamiehdamihvvfyplfttnngvadted
    virhidhicelgglknigfgsdfdgipdhvkglehvgkyqsfletlekhytkeeiegfas
    rnflnhlpk
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nehB (B:)
    mslrvidthcdalyklqagkgkytfqdaeeldvnferlieakmllqgfaifldedipveh
    kwkkaveqvnifkqhvlhkggiihhvkkwcdlenlpedkigamltlegiepigrdldklt
    qlldggvlsvgltwnnanlaadgimeergagltrfgkdiihllnerkvftdvshlsvkaf
    wetleqaefviashsnakaicshprnlddeqikamiehdamihvvfyplfttnngvadte
    dvirhidhicelgglknigfgsdfdgipdhvkglehvgkyqsfletlekhytkeeiegfa
    srnflnhlpkeghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nehB (B:)
    slrvidthcdalyklqagkgkytfqdaeeldvnferlieakmllqgfaifldedipvehk
    wkkaveqvnifkqhvlhkggiihhvkkwcdlenlpedkigamltlegiepigrdldkltq
    lldggvlsvgltwnnanlaadgimeergagltrfgkdiihllnerkvftdvshlsvkafw
    etleqaefviashsnakaicshprnlddeqikamiehdamihvvfyplfttnngvadted
    virhidhicelgglknigfgsdfdgipdhvkglehvgkyqsfletlekhytkeeiegfas
    rnflnhlpk