PDB entry 3neg

View 3neg on RCSB PDB site
Description: Pyrabactin-bound PYL1 structure in the open and close forms
Deposited on 2010-06-08, released 2010-06-16
The last revision was dated 2010-09-15, with a file datestamp of 2010-09-10.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.197
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Abscisic acid receptor PYL1
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Abscisic acid receptor PYL1
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PYV, BR, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3negA (A:)
    istlhhqtmpsdltqdeftqlsqsiaefhtyqlgngrcssllaqrihappetvwsvvrrf
    drpqiykhfikscnvsedfemrvgctrdvnvisglpantsrerldlldddrrvtgfsitg
    gehrlrnyksvttvhrfekeeeeeriwtvvlesyvvdvpegnseedtrlfadtvirlnlq
    klasiteamnrnnnnnnssqvr
    

    Sequence, based on observed residues (ATOM records):
    >3negA (A:)
    hhqtmpsdltqdeftqlsqsiaefhtyqlgngrcssllaqrihappetvwsvvrrfdrpq
    iykhfikscnvsedfemrvgctrdvnvisglpantsrerldlldddrrvtgfsitggehr
    lrnyksvttvhrfekriwtvvlesyvvdvpegnseedtrlfadtvirlnlqklasiteam
    nr
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3negB (B:)
    istlhhqtmpsdltqdeftqlsqsiaefhtyqlgngrcssllaqrihappetvwsvvrrf
    drpqiykhfikscnvsedfemrvgctrdvnvisglpantsrerldlldddrrvtgfsitg
    gehrlrnyksvttvhrfekeeeeeriwtvvlesyvvdvpegnseedtrlfadtvirlnlq
    klasiteamnrnnnnnnssqvr
    

    Sequence, based on observed residues (ATOM records):
    >3negB (B:)
    sdltqdeftqlsqsiaefhtyqlgngrcssllaqrihappetvwsvvrrfdrpqiykhfi
    kscnvsedfemrvgctrdvnvisglpantsrerldlldddrrvtgfsitggehrlrnyks
    vttvhrfekiwtvvlesyvvdvpegnseedtrlfadtvirlnlqklasiteamnrnn