PDB entry 3ned

View 3ned on RCSB PDB site
Description: mRouge
Class: fluorescent protein
Keywords: RFP, mCherry, beta barrel, FLUORESCENT PROTEIN
Deposited on 2010-06-08, released 2010-11-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 0.95 Å
R-factor: N/A
AEROSPACI score: 0.87 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PAmCherry1 protein
    Species: DISCOSOMA SP. [TaxId:86600]
    Gene: PAmCherry, PAmCherry1
    Database cross-references and differences (RAF-indexed):
    • Uniprot D1MPT3 (Start-247)
      • engineered mutation (28)
      • engineered mutation (38)
      • engineered mutation (69)
      • chromophore (78)
      • engineered mutation (86)
      • engineered mutation (99)
      • engineered mutation (114)
      • engineered mutation (162)
      • engineered mutation (177)
      • engineered mutation (179)
      • engineered mutation (181)
      • engineered mutation (211)
      • engineered mutation (213)
      • engineered mutation (233)
    Domains in SCOPe 2.07: d3neda_
  • Heterogens: NA, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nedA (A:)
    mghhhhhhgvskgeednmaiikefmrfkthmegsvnghefeiegegegrpyegtqtaklk
    vtkggplpfawdilspqfmygmygxskayvkhpadipdylklsfpegfkwervmnfedgg
    vvtvtqdsslqdgefiykvklrgtnfpsdgpvmqkktmgweacsermypedgalkgemkm
    rlklkdgghydaevkttykakkpvqlpgayntntklditshnedytiveqyernegrhst
    ggmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nedA (A:)
    eednmaiikefmrfkthmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdi
    lspqfmygmygxskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqdsslqdg
    efiykvklrgtnfpsdgpvmqkktmgweacsermypedgalkgemkmrlklkdgghydae
    vkttykakkpvqlpgayntntklditshnedytiveqyernegrhstggmdelyk