PDB entry 3nea

View 3nea on RCSB PDB site
Description: Crystal Structure of Peptidyl-tRNA hydrolase from Francisella tularensis
Class: hydrolase
Keywords: hydrolase, peptidyl-tRNA
Deposited on 2010-06-08, released 2011-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-tRNA hydrolase
    Species: Francisella tularensis subsp. tularensis [TaxId:119856]
    Gene: FTT_0680c, pth
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3neaa_
  • Heterogens: CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3neaA (A:)
    gsshhhhhhssglvprgshmpkikmiiglgnigkeyqdtrhnvgewfiakiaqdnnqsfs
    snpklncnlakvsidynnvvlvfpttymnnsglavskvanfykiapaeilvvhdeldids
    geirlkkggghgghnglrsinqhlgtndylrlrigighpghkskvanyvlsnpsiaqkkd
    idsaidngicflddiinyklepvmqkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3neaA (A:)
    pkikmiiglgnigkeyqdtrhnvgewfiakiaqdnnqsfssnpklncnlakvsidynnvv
    lvfpttymnnsglavskvanfykiapaeilvvhdeldidsgeirlkkggghgghnglrsi
    nqhlgtndylrlrigighpghkskvanyvlsnpsiaqkkdidsaidngicflddiinykl
    epvmqkl