PDB entry 3ne6

View 3ne6 on RCSB PDB site
Description: RB69 DNA Polymerase (S565G/Y567A) Ternary Complex with dCTP Opposite dG
Class: transferase/DNA
Keywords: RB69 DNA polymerase, fidelity, Mutation Frequencies, Kinetics, TRANSFERASE-DNA complex
Deposited on 2010-06-08, released 2011-01-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-03-02, with a file datestamp of 2011-02-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.186
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase
    Species: Enterobacteria phage RB69 [TaxId:12353]
    Gene: 43, gp43
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q38087 (0-902)
      • engineered mutation (221)
      • engineered mutation (326)
      • engineered mutation (564)
      • engineered mutation (566)
    Domains in SCOPe 2.07: d3ne6a1, d3ne6a2
  • Chain 'P':
    Compound: DNA (5'-d(*gp*cp*gp*gp*ap*cp*tp*gp*cp*tp*tp*ap*(doc))-3')
  • Chain 'T':
    Compound: DNA (5'-d(*tp*cp*ap*gp*gp*tp*ap*ap*gp*cp*ap*gp*tp*cp*cp*gp*cp*g)-3')
  • Heterogens: CA, DCP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ne6A (A:)
    mkefyltveqigdsiferyidsngrertreveykpslfahcpesqatkyfdiygkpctrk
    lfanmrdasqwikrmediglealgmddfklaylsdtynyeikydhtkirvanfdievtsp
    dgfpepsqakhpidaithydsiddrfyvfdllnspygnveewsieiaaklqeqggdevps
    eiidkiiympfdnekellmeylnfwqqktpviltgwnvesfaipyvynriknifgestak
    rlsphrktrvkvienmygsreiitlfgisvldyidlykkfsftnqpsysldyisefelnv
    gklkydgpisklresnhqryisyniiavyrvlqidakrqfinlsldmgyyakiqiqsvfs
    piktwdaiifnslkeqnkvipqgrshpvqpypgafvkepipnrykyvmsfdltslypsii
    rqvnispetiagtfkvaplhdyinavaerpsdvyscspngmmyykdrdgvvpteitkvfn
    qrkehkgymlaaqrngeiikealhnpnlsvdepldvdyrfdfsdeikekikklsakslne
    mlfraqrtevagmtaqinrkllinglagalgnvwfryydlrnataittfgqmalqwierk
    vneylnevcgtegeafvlygdtdsiyvsadkiidkvgeskfrdtnhwvdfldkfarerme
    paidrgfremceymnnkqhlmfmdreaiagpplgskgiggfwtgkkryalnvwdmegtry
    aepklkimgletqksstpkavqkalkecirrmlqegeeslqeyfkefekefrqlnyisia
    svssanniakydvggfpgpkcpfhirgiltynraikgnidapqvvegekvyvlplregnp
    fgdkciawpsgteitdlikddvlhwmdytvllektfikplegftsaakldyekkaslfdm
    fdf
    

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.